Human ISG15/IFI15/UCRP ORF/cDNA clone-Lentivirus particle (BC009507)

Cat. No.: vGMLP003914

Pre-made Human ISG15/IFI15/UCRP Lentiviral expression plasmid for ISG15 lentivirus packaging, ISG15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ISG15/IFI15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003914 Human ISG15 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003914
Gene Name ISG15
Accession Number BC009507
Gene ID 9636
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias IFI15,UCRP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGTCGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGTCCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACGGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAACATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTGCGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGCGGAGCTAA
ORF Protein Sequence MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1038-Ab Anti-ISG15/ G1P2/ IFI15 functional antibody
    Target Antigen GM-Tg-g-SE1038-Ag ISG15 protein
    ORF Viral Vector pGMLP003914 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLP003916 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV001459 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV002495 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMAP000080 Human ISG15 Adenovirus plasmid
    ORF Viral Vector pGMPC000948 Human ISG15 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003914 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLP003916 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV001459 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV002495 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMAP000080 Human ISG15 Adenovirus particle


    Target information

    Target ID GM-SE1038
    Target Name ISG15
    Gene ID 9636, 100038882, 700141, 298693, 100174787, 100855667, 281871, 100066364
    Gene Symbol and Synonyms G1P2,hUCRP,IFI15,IGI15,IMD38,IP17,Irfp,ISG15,UCRP
    Uniprot Accession P05161
    Uniprot Entry Name ISG15_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000187608
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.