Human ISG15/IFI15/UCRP ORF/cDNA clone-Lentivirus particle (BC009507)
Cat. No.: vGMLP003914
Pre-made Human ISG15/IFI15/UCRP Lentiviral expression plasmid for ISG15 lentivirus packaging, ISG15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ISG15/IFI15 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003914 | Human ISG15 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003914 |
Gene Name | ISG15 |
Accession Number | BC009507 |
Gene ID | 9636 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 498 bp |
Gene Alias | IFI15,UCRP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGTCGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGTCCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACGGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAACATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTGCGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGCGGAGCTAA |
ORF Protein Sequence | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1038-Ab | Anti-ISG15/ G1P2/ IFI15 functional antibody |
Target Antigen | GM-Tg-g-SE1038-Ag | ISG15 protein |
ORF Viral Vector | pGMLP003914 | Human ISG15 Lentivirus plasmid |
ORF Viral Vector | pGMLP003916 | Human ISG15 Lentivirus plasmid |
ORF Viral Vector | pGMLV001459 | Human ISG15 Lentivirus plasmid |
ORF Viral Vector | pGMLV002495 | Human ISG15 Lentivirus plasmid |
ORF Viral Vector | pGMAP000080 | Human ISG15 Adenovirus plasmid |
ORF Viral Vector | pGMPC000948 | Human ISG15 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP003914 | Human ISG15 Lentivirus particle |
ORF Viral Vector | vGMLP003916 | Human ISG15 Lentivirus particle |
ORF Viral Vector | vGMLV001459 | Human ISG15 Lentivirus particle |
ORF Viral Vector | vGMLV002495 | Human ISG15 Lentivirus particle |
ORF Viral Vector | vGMAP000080 | Human ISG15 Adenovirus particle |
Target information
Target ID | GM-SE1038 |
Target Name | ISG15 |
Gene ID | 9636, 100038882, 700141, 298693, 100174787, 100855667, 281871, 100066364 |
Gene Symbol and Synonyms | G1P2,hUCRP,IFI15,IGI15,IMD38,IP17,Irfp,ISG15,UCRP |
Uniprot Accession | P05161 |
Uniprot Entry Name | ISG15_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000187608 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.