Human ISG15/IFI15/UCRP ORF/cDNA clone-Adenovirus particle (BC009507)

Cat. No.: vGMAP000080

Pre-made Human ISG15/IFI15/UCRP Adenovirus for ISG15 overexpression in-vitro and in-vivo. The ISG15 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ISG15-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to ISG15/IFI15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000080 Human ISG15 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000080
Gene Name ISG15
Accession Number BC009507
Gene ID 9636
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 498 bp
Gene Alias IFI15,UCRP
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGTCGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGTCCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACGGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAACATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTGCGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGCGGAGCTAA
ORF Protein Sequence MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1038-Ab Anti-ISG15/ G1P2/ IFI15 functional antibody
    Target Antigen GM-Tg-g-SE1038-Ag ISG15 protein
    ORF Viral Vector pGMLP003914 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLP003916 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV001459 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV002495 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMAP000080 Human ISG15 Adenovirus plasmid
    ORF Viral Vector pGMPC000948 Human ISG15 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003914 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLP003916 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV001459 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV002495 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMAP000080 Human ISG15 Adenovirus particle


    Target information

    Target ID GM-SE1038
    Target Name ISG15
    Gene ID 9636, 100038882, 700141, 298693, 100174787, 100855667, 281871, 100066364
    Gene Symbol and Synonyms G1P2,hUCRP,IFI15,IGI15,IMD38,IP17,Irfp,ISG15,UCRP
    Uniprot Accession P05161
    Uniprot Entry Name ISG15_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000187608
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.