Human ISG15/IFI15/UCRP ORF/cDNA clone-Adenovirus plasmid (BC009507)

Cat. No.: pGMAP000080
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ISG15/IFI15/UCRP adenoviral expression plasmid for ISG15 adenovirus packaging, ISG15 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to ISG15/IFI15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000080
Gene Name ISG15
Accession Number BC009507
Gene ID 9636
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 498 bp
Gene Alias IFI15,UCRP
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGTCGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGTCCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACGGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAACATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTGCGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGCGGAGCTAA
ORF Protein Sequence MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1038-Ab Anti-ISG15/ G1P2/ IFI15 functional antibody
    Target Antigen GM-Tg-g-SE1038-Ag ISG15 protein
    ORF Viral Vector pGMLP003914 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLP003916 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV001459 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMLV002495 Human ISG15 Lentivirus plasmid
    ORF Viral Vector pGMAP000080 Human ISG15 Adenovirus plasmid
    ORF Viral Vector pGMPC000948 Human ISG15 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003914 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLP003916 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV001459 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMLV002495 Human ISG15 Lentivirus particle
    ORF Viral Vector vGMAP000080 Human ISG15 Adenovirus particle


    Target information

    Target ID GM-SE1038
    Target Name ISG15
    Gene ID 9636, 100038882, 700141, 298693, 100174787, 100855667, 281871, 100066364
    Gene Symbol and Synonyms G1P2,hUCRP,IFI15,IGI15,IMD38,IP17,Irfp,ISG15,UCRP
    Uniprot Accession P05161
    Uniprot Entry Name ISG15_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000187608
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.