Human TIMP1/EPA/EPO ORF/cDNA clone-Adenovirus particle (BC000866)

Cat. No.: vGMAP000455

Pre-made Human TIMP1/EPA/EPO Adenovirus for TIMP1 overexpression in-vitro and in-vivo. The TIMP1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TIMP1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TIMP1/EPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000455 Human TIMP1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000455
Gene Name TIMP1
Accession Number BC000866
Gene ID 7076
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 624 bp
Gene Alias EPA,EPO,HCI
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCCCTTTGAGCCCCTGGCTTCTGGCATCCTGTTGTTGCTGTGGCTGATAGCCCCCAGCAGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTCGTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATACCAGCGTTATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAGGATGGACTCTTGCACATCACTACCTGCAGTTTCGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGCAAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAGGGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGGCAGTCCCTGCGGTCCCAGATAGCCTGA
ORF Protein Sequence MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0506-Ab Anti-TIMP1/ CLGI/ EPA functional antibody
    Target Antigen GM-Tg-g-SE0506-Ag TIMP1 protein
    ORF Viral Vector pGMLP001347 Human TIMP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000257 Human TIMP1 Lentivirus plasmid
    ORF Viral Vector pGMAP000455 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMAP000469 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMAP000553 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMPC001587 Human TIMP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001347 Human TIMP1 Lentivirus particle
    ORF Viral Vector vGMLV000257 Human TIMP1 Lentivirus particle
    ORF Viral Vector vGMAP000455 Human TIMP1 Adenovirus particle
    ORF Viral Vector vGMAP000469 Human TIMP1 Adenovirus particle
    ORF Viral Vector vGMAP000553 Human TIMP1 Adenovirus particle


    Target information

    Target ID GM-SE0506
    Target Name TIMP1
    Gene ID 7076, 21857, 574348, 116510, 101095886, 403816, 282092, 100034220
    Gene Symbol and Synonyms CLGI,EPA,EPO,HCI,TIMP,TIMP-1,TIMP1,TPA-S1
    Uniprot Accession P01033
    Uniprot Entry Name TIMP1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease Dent disease, Vesicoureteral reflux
    Gene Ensembl ENSG00000102265
    Target Classification Not Available

    This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.