Human S100A8/60B8AG/CGLA ORF/cDNA clone-Adenovirus particle (BC005928)

Cat. No.: vGMAP000312

Pre-made Human S100A8/60B8AG/CGLA Adenovirus for S100A8 overexpression in-vitro and in-vivo. The S100A8 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified S100A8-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to S100A8/60B8AG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000312 Human S100A8 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000312
Gene Name S100A8
Accession Number BC005928
Gene ID 6279
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 282 bp
Gene Alias 60B8AG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGACCGAGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGGGGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATCAGGAAAAAGGGTGCAGACGTCTGGTTCAAAGAGTTGGATATCAACACTGATGGTGCAGTTAACTTCCAGGAGTTCCTCATTCTGGTGATAAAGATGGGCGTGGCAGCCCACAAAAAAAGCCATGAAGAAAGCCACAAAGAGTAG
ORF Protein Sequence MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T27402-Ab Anti-S10A8/ S100A8/ 60B8AG monoclonal antibody
    Target Antigen GM-Tg-g-T27402-Ag S100A8 VLP (virus-like particle)
    ORF Viral Vector pGMLP000464 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMLV000491 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMLV000751 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMAP000312 Human S100A8 Adenovirus plasmid
    ORF Viral Vector vGMLP000464 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMLV000491 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMLV000751 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMAP000312 Human S100A8 Adenovirus particle


    Target information

    Target ID GM-T27402
    Target Name S100A8
    Gene ID 6279, 20201, 714740, 116547, 101084164, 490461, 616818, 100061766
    Gene Symbol and Synonyms 60B8AG,B8Ag,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8,S100-A8,S100A8
    Uniprot Accession P05109
    Uniprot Entry Name S10A8_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Acute appendicitis, Congenital occlusion of ureteropelvic junction, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Malignant neoplasm of bladder
    Gene Ensembl ENSG00000143546
    Target Classification Not Available

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.