Human IL36G/IL-1F9/IL-1H1 ORF/cDNA clone-Lentivirus plasmid (NM_019618)

Cat. No.: pGMLP-IL-041
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL36G/IL-1F9/IL-1H1 Lentiviral expression plasmid for IL36G lentivirus packaging, IL36G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL36G/IL-1F9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $427.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-IL-041
Gene Name IL36G
Accession Number NM_019618
Gene ID 56300
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 510 bp
Gene Alias IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGGCACTCCAGGAGACGCTGATGGTGGAGGAAGGGCCGTCTATCAATCAATGTGTAAACCTATTACTGGGACTATTAATGATTTGAATCAGCAAGTGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGTGTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCTTGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAATGTGTTTGTATTGTGAGAAGGTTGGAGAACAGCCCACATTGCAGCTAAAAGAGCAGAAGATCATGGATCTGTATGGCCAACCCGAGCCCGTGAAACCCTTCCTTTTCTACCGTGCCAAGACTGGTAGGACCTCCACCCTTGAGTCTGTGGCCTTCCCGGACTGGTTCATTGCCTCCTCCAAGAGAGACCAGCCCATCATTCTGACTTCAGAACTTGGGAAGTCATACAACACTGCCTTTGAATTAAATATAAATGACTGA
ORF Protein Sequence MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72514-Ab Anti-IL36G/ IL-1F9/ IL-1H1 monoclonal antibody
    Target Antigen GM-Tg-g-T72514-Ag IL36G VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T72514 interleukin 36, gamma (IL36G) protein & antibody
    ORF Viral Vector pGMLP003211 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-041 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-124 Human IL36G Adenovirus plasmid
    ORF Viral Vector vGMLP003211 Human IL36G Lentivirus particle
    ORF Viral Vector vGMLP-IL-041 Human IL36G Lentivirus particle
    ORF Viral Vector vGMAP-IL-124 Human IL36G Adenovirus particle


    Target information

    Target ID GM-T72514
    Target Name IL36G
    Gene ID 56300, 215257, 700822, 499744, 101081377, 100686137, 615762
    Gene Symbol and Synonyms If36g,IL-1F9,IL-1H1,IL-1RP2,IL-36gamma,IL1E,IL1F9,IL1H1,IL1RP2,IL36G,RGD1563019
    Uniprot Accession Q9NZH8
    Uniprot Entry Name IL36G_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000136688
    Target Classification Not Available

    The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.