Human IL36G/IL-1F9/IL-1H1 ORF/cDNA clone-Adenovirus plasmid (NM_019618)
Cat. No.: pGMAP-IL-124
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL36G/IL-1F9/IL-1H1 adenoviral expression plasmid for IL36G adenovirus packaging, IL36G adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL36G/IL-1F9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP-IL-124 |
Gene Name | IL36G |
Accession Number | NM_019618 |
Gene ID | 56300 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 510 bp |
Gene Alias | IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGAGAGGCACTCCAGGAGACGCTGATGGTGGAGGAAGGGCCGTCTATCAATCAATGTGTAAACCTATTACTGGGACTATTAATGATTTGAATCAGCAAGTGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGTGTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCTTGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAATGTGTTTGTATTGTGAGAAGGTTGGAGAACAGCCCACATTGCAGCTAAAAGAGCAGAAGATCATGGATCTGTATGGCCAACCCGAGCCCGTGAAACCCTTCCTTTTCTACCGTGCCAAGACTGGTAGGACCTCCACCCTTGAGTCTGTGGCCTTCCCGGACTGGTTCATTGCCTCCTCCAAGAGAGACCAGCCCATCATTCTGACTTCAGAACTTGGGAAGTCATACAACACTGCCTTTGAATTAAATATAAATGACTGA |
ORF Protein Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T72514-Ab | Anti-IL36G/ IL-1F9/ IL-1H1 monoclonal antibody |
Target Antigen | GM-Tg-g-T72514-Ag | IL36G VLP (virus-like particle) |
Cytokine | cks-Tg-g-GM-T72514 | interleukin 36, gamma (IL36G) protein & antibody |
ORF Viral Vector | pGMLP003211 | Human IL36G Lentivirus plasmid |
ORF Viral Vector | pGMLP-IL-041 | Human IL36G Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-124 | Human IL36G Adenovirus plasmid |
ORF Viral Vector | vGMLP003211 | Human IL36G Lentivirus particle |
ORF Viral Vector | vGMLP-IL-041 | Human IL36G Lentivirus particle |
ORF Viral Vector | vGMAP-IL-124 | Human IL36G Adenovirus particle |
Target information
Target ID | GM-T72514 |
Target Name | IL36G |
Gene ID | 56300, 215257, 700822, 499744, 101081377, 100686137, 615762 |
Gene Symbol and Synonyms | If36g,IL-1F9,IL-1H1,IL-1RP2,IL-36gamma,IL1E,IL1F9,IL1H1,IL1RP2,IL36G,RGD1563019 |
Uniprot Accession | Q9NZH8 |
Uniprot Entry Name | IL36G_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000136688 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.