Human B2M/IMD43 ORF/cDNA clone-Lentivirus particle (NM_004048)

Cat. No.: vGMLV002489

Pre-made Human B2M/IMD43 Lentiviral expression plasmid for B2M lentivirus packaging, B2M lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to B2M/IMD43 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV002489 Human B2M Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV002489
Gene Name B2M
Accession Number NM_004048
Gene ID 567
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 360 bp
Gene Alias IMD43
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA
ORF Protein Sequence MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58080-Ab Anti-B2MG/ B2M/ IMD43 monoclonal antibody
    Target Antigen GM-Tg-g-T58080-Ag B2M VLP (virus-like particle)
    ORF Viral Vector pGMLP000539 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMLV002489 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMAP000411 Human B2M Adenovirus plasmid
    ORF Viral Vector vGMLP000539 Human B2M Lentivirus particle
    ORF Viral Vector vGMLV002489 Human B2M Lentivirus particle
    ORF Viral Vector vGMAP000411 Human B2M Adenovirus particle


    Target information

    Target ID GM-T58080
    Target Name B2M
    Gene ID 567, 12010, 712428, 24223, 494145, 100855741, 100034203
    Gene Symbol and Synonyms B2M,beta2-m,beta2m,IMD43,Ly-m11
    Uniprot Accession P61769
    Uniprot Entry Name B2MG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Ovary Cancer, Urinary tract obstruction, Malignant neoplasm of prostate, Congenital occlusion of ureteropelvic junction, Acute kidney failure, Asphyxia neonatorum, Autosomal Dominant Polycystic Kidney Disease, Balkan nephropathy, Bronchopulmonary Dysplasia, Dent disease, Kidney transplant rejection, lymphomas, Malignant neoplasm of colon, Nephropathy induced by other drugs, medicaments and biological substances, Nephrotic syndrome, Proteinuria, Renal fibrosis, Peripheral T-cell lymphomas (PTCL)
    Gene Ensembl ENSG00000166710
    Target Classification Not Available

    This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.