Human B2M ORF/cDNA clone-Adenovirus particle (BC032589)

Cat. No.: vGMAP000411

Pre-made Human B2M/ Adenovirus for B2M overexpression in-vitro and in-vivo. The B2M adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified B2M-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to B2M/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000411 Human B2M Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000411
Gene Name B2M
Accession Number BC032589
Gene ID 567
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 360 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA
ORF Protein Sequence MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58080-Ab Anti-B2MG/ B2M/ IMD43 monoclonal antibody
    Target Antigen GM-Tg-g-T58080-Ag B2M VLP (virus-like particle)
    ORF Viral Vector pGMLP000539 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMLV002489 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMAP000411 Human B2M Adenovirus plasmid
    ORF Viral Vector vGMLP000539 Human B2M Lentivirus particle
    ORF Viral Vector vGMLV002489 Human B2M Lentivirus particle
    ORF Viral Vector vGMAP000411 Human B2M Adenovirus particle


    Target information

    Target ID GM-T58080
    Target Name B2M
    Gene ID 567, 12010, 712428, 24223, 494145, 100855741, 100034203
    Gene Symbol and Synonyms B2M,beta2-m,beta2m,IMD43,Ly-m11
    Uniprot Accession P61769
    Uniprot Entry Name B2MG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Ovary Cancer, Urinary tract obstruction, Malignant neoplasm of prostate, Congenital occlusion of ureteropelvic junction, Acute kidney failure, Asphyxia neonatorum, Autosomal Dominant Polycystic Kidney Disease, Balkan nephropathy, Bronchopulmonary Dysplasia, Dent disease, Kidney transplant rejection, lymphomas, Malignant neoplasm of colon, Nephropathy induced by other drugs, medicaments and biological substances, Nephrotic syndrome, Proteinuria, Renal fibrosis, Peripheral T-cell lymphomas (PTCL)
    Gene Ensembl ENSG00000166710
    Target Classification Not Available

    This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.