Human PPIA/CYPA/CYPH ORF/cDNA clone-Lentivirus particle (NM_021130.5)
Cat. No.: vGMLV002305
Pre-made Human PPIA/CYPA/CYPH Lentiviral expression plasmid for PPIA lentivirus packaging, PPIA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PPIA/CYPA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002305 | Human PPIA Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002305 |
Gene Name | PPIA |
Accession Number | NM_021130.5 |
Gene ID | 5478 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 498 bp |
Gene Alias | CYPA,CYPH,HEL-S-69p |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGTCAACCCCACCGTGTTCTTCGACATTGCCGTCGACGGCGAGCCCTTGGGCCGCGTCTCCTTTGAGCTGTTTGCAGACAAGGTCCCAAAGACAGCAGAAAATTTTCGTGCTCTGAGCACTGGAGAGAAAGGATTTGGTTATAAGGGTTCCTGCTTTCACAGAATTATTCCAGGGTTTATGTGTCAGGGTGGTGACTTCACACGCCATAATGGCACTGGTGGCAAGTCCATCTATGGGGAGAAATTTGAAGATGAGAACTTCATCCTAAAGCATACGGGTCCTGGCATCTTGTCCATGGCAAATGCTGGACCCAACACAAATGGTTCCCAGTTTTTCATCTGCACTGCCAAGACTGAGTGGTTGGATGGCAAGCATGTGGTGTTTGGCAAAGTGAAAGAAGGCATGAATATTGTGGAGGCCATGGAGCGCTTTGGGTCCAGGAATGGCAAGACCAGCAAGAAGATCACCATTGCTGACTGTGGACAACTCGAATAA |
ORF Protein Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T47081-Ab | Anti-PPIA/ CYPA/ CYPH functional antibody |
Target Antigen | GM-Tg-g-T47081-Ag | PPIA protein |
ORF Viral Vector | pGMLV002304 | Human PPIA Lentivirus plasmid |
ORF Viral Vector | pGMLV002305 | Human PPIA Lentivirus plasmid |
ORF Viral Vector | pGMAD001436 | Human PPIA Adenovirus plasmid |
ORF Viral Vector | pGMAD001443 | Human PPIA Adenovirus plasmid |
ORF Viral Vector | pGMAP000039 | Human PPIA Adenovirus plasmid |
ORF Viral Vector | vGMLV002304 | Human PPIA Lentivirus particle |
ORF Viral Vector | vGMLV002305 | Human PPIA Lentivirus particle |
ORF Viral Vector | vGMAD001436 | Human PPIA Adenovirus particle |
ORF Viral Vector | vGMAD001443 | Human PPIA Adenovirus particle |
ORF Viral Vector | vGMAP000039 | Human PPIA Adenovirus particle |
Target information
Target ID | GM-T47081 |
Target Name | PPIA |
Gene ID | 5478, 268373, 574102, 25518, 493966, 608151, 281418, 100052020 |
Gene Symbol and Synonyms | Cphn,CYCA,CyP-18,CyP-A,CYPA,CYPH,HEL-S-69p,MT-ND1,MTND1,NADH1,ND1,p1B15,p31,PPIA,SP18 |
Uniprot Accession | P62937 |
Uniprot Entry Name | PPIA_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000196262 |
Target Classification | Not Available |
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.