Human FNDC5/FRCP2/irisin ORF/cDNA clone-Lentivirus particle (NM_001171941)

Cat. No.: vGMLV001869

Pre-made Human FNDC5/FRCP2/irisin Lentiviral expression plasmid for FNDC5 lentivirus packaging, FNDC5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FNDC5/FRCP2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001869 Human FNDC5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001869
Gene Name FNDC5
Accession Number NM_001171941
Gene ID 252995
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 462 bp
Gene Alias FRCP2,irisin
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCGCTTCATCCAGGAGGTGAACACCACCACCCGCTCATGTGCCCTCTGGGACCTGGAGGAGGATACGGAGTACATAGTCCACGTGCAGGCCATCTCCATTCAGGGCCAGAGCCCAGCCAGCGAGCCTGTGCTCTTCAAGACCCCGCGTGAGGCTGAGAAGATGGCCTCCAAGAACAAAGATGAGGTAACCATGAAAGAGATGGGGAGGAACCAACAGCTGCGGACAGGCGAGGTGCTGATCATCGTCGTGGTCCTGTTCATGTGGGCAGGTGTCATTGCCCTCTTCTGCCGCCAGTATGACATCATCAAGGACAATGAACCCAATAACAACAAGGAAAAAACCAAGAGTGCATCAGAAACCAGCACACCAGAGCACCAGGGCGGGGGGCTTCTCCGCAGCAAGGTGAGGGCAAGACCTGGGCCTGGGTGGGCCACCCTGTGCCTCATGCTCTGGTAA
ORF Protein Sequence MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0449-Ab Anti-FNDC5/ FRCP2/ irisin monoclonal antibody
    Target Antigen GM-Tg-g-MP0449-Ag FNDC5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000060 Human FNDC5 Lentivirus plasmid
    ORF Viral Vector pGMLV001869 Human FNDC5 Lentivirus plasmid
    ORF Viral Vector vGMLP000060 Human FNDC5 Lentivirus particle
    ORF Viral Vector vGMLV001869 Human FNDC5 Lentivirus particle


    Target information

    Target ID GM-MP0449
    Target Name FNDC5
    Gene ID 252995, 384061, 710159, 260327, 101083019, 487302, 538905, 100146454
    Gene Symbol and Synonyms 1500001L03Rik,FNDC5,FRCP2,irisin,PeP,Pxp
    Uniprot Accession Q8NAU1
    Uniprot Entry Name FNDC5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160097
    Target Classification Not Available

    This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.