Human CCL5/D17S136E/eoCP ORF/cDNA clone-Lentivirus particle (NM_002985.3)

Cat. No.: vGMLV001626

Pre-made Human CCL5/D17S136E/eoCP Lentiviral expression plasmid for CCL5 lentivirus packaging, CCL5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CCL5/D17S136E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001626 Human CCL5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001626
Gene Name CCL5
Accession Number NM_002985.3
Gene ID 6352
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 276 bp
Gene Alias D17S136E,eoCP,RANTES,SCYA5,SIS-delta,SISd,TCP228
Fluorescent Reporter ZsGreen-Firefly luciferase
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCTCCGCGGCAGCCCTCGCTGTCATCCTCATTGCTACTGCCCTCTGCGCTCCTGCATCTGCCTCCCCATATTCCTCGGACACCACACCCTGCTGCTTTGCCTACATTGCCCGCCCACTGCCCCGTGCCCACATCAAGGAGTATTTCTACACCAGTGGCAAGTGCTCCAACCCAGCAGTCGTCTTTGTCACCCGAAAGAACCGCCAAGTGTGTGCCAACCCAGAGAAGAAATGGGTTCGGGAGTACATCAACTCTTTGGAGATGAGCTAG
ORF Protein Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16263-Ab Anti-CCL5/ D17S136E/ RANTES functional antibody
    Target Antigen GM-Tg-g-T16263-Ag CCL5 protein
    Cytokine cks-Tg-g-GM-T16263 chemokine (C-C motif) ligand 5 (CCL5) protein & antibody
    ORF Viral Vector pGMLV001580 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001626 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001699 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001882 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMAP000013 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMAP000062 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMPC000787 Human CCL5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001580 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001626 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001699 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001882 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMAP000013 Human CCL5 Adenovirus particle
    ORF Viral Vector vGMAP000062 Human CCL5 Adenovirus particle


    Target information

    Target ID GM-T16263
    Target Name CCL5
    Gene ID 6352, 20304, 574178, 81780, 493689, 403522, 327712, 100033925
    Gene Symbol and Synonyms CCL5,D17S136E,eoCP,MuRantes,RANTES,SCYA5,SIS-delta,SISd,TCP228
    Uniprot Accession P13501
    Uniprot Entry Name CCL5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease Breast Cancer, Type 1 diabetes mellitus, Chronic Kidney Disease
    Gene Ensembl ENSG00000271503
    Target Classification Not Available

    This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.