Human CCL5/MGC17164/RANTES ORF/cDNA clone-Adenovirus particle (BC008600)

Cat. No.: vGMAP000013

Pre-made Human CCL5/MGC17164/RANTES Adenovirus for CCL5 overexpression in-vitro and in-vivo. The CCL5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CCL5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CCL5/MGC17164 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000013 Human CCL5 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000013
Gene Name CCL5
Accession Number BC008600
Gene ID 6352
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 276 bp
Gene Alias MGC17164,RANTES,SISd,TCP228
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAGGTCTCCGCGGCAGCCCTCGCTGTCATCCTCATTGCTACTGCCCTCTGCGCTCCTGCATCTGCCTCCCCATATTCCTCGGACACCACACCCTGCTGCTTTGCCTACATTGCCCGCCCACTGCCCCGTGCCCACATCAAGGAGTATTTCTACACCAGTGGCAAGTGCTCCAACCCAGCAGTCGTCTTTGTCACCCGAAAGAACCGCCAAGTGTGTGCCAACCCAGAGAAGAAATGGGTTCGGGAGTACATCAACTCTTTGGAGATGAGCTAG
ORF Protein Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16263-Ab Anti-CCL5/ D17S136E/ RANTES functional antibody
    Target Antigen GM-Tg-g-T16263-Ag CCL5 protein
    Cytokine cks-Tg-g-GM-T16263 chemokine (C-C motif) ligand 5 (CCL5) protein & antibody
    ORF Viral Vector pGMLV001580 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001626 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001699 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001882 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMAP000013 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMAP000062 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMPC000787 Human CCL5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001580 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001626 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001699 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001882 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMAP000013 Human CCL5 Adenovirus particle
    ORF Viral Vector vGMAP000062 Human CCL5 Adenovirus particle


    Target information

    Target ID GM-T16263
    Target Name CCL5
    Gene ID 6352, 20304, 574178, 81780, 493689, 403522, 327712, 100033925
    Gene Symbol and Synonyms CCL5,D17S136E,eoCP,MuRantes,RANTES,SCYA5,SIS-delta,SISd,TCP228
    Uniprot Accession P13501
    Uniprot Entry Name CCL5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease Breast Cancer, Type 1 diabetes mellitus, Chronic Kidney Disease
    Gene Ensembl ENSG00000271503
    Target Classification Not Available

    This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.