Human GUCA2B/GCAP-II/UGN ORF/cDNA clone-Lentivirus particle (NM_007102)

Cat. No.: vGMLP005002

Pre-made Human GUCA2B/GCAP-II/UGN Lentiviral expression plasmid for GUCA2B lentivirus packaging, GUCA2B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GUCA2B/GCAP-II products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005002 Human GUCA2B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005002
Gene Name GUCA2B
Accession Number NM_007102
Gene ID 2981
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 339 bp
Gene Alias GCAP-II,UGN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTGCAGGGCTGCATCAGGGCTCCTGCCAGGAGTGGCCGTGGTCCTCCTGCTGCTGCTGCAGAGCACACAGTCAGTCTACATCCAGTACCAAGGCTTCCGGGTCCAGCTGGAATCCATGAAGAAGCTGAGTGACCTGGAGGCACAGTGGGCACCCAGCCCCCGCCTGCAGGCCCAGAGCCTCCTGCCCGCCGTGTGCCACCACCCTGCTCTGCCTCAGGACCTTCAGCCTGTCTGCGCCTCGCAGGAGGCTTCCAGCATCTTCAAGACCCTGAGGACCATCGCTAACGACGACTGTGAGCTGTGTGTGAACGTTGCGTGTACCGGCTGCCTCTGA
ORF Protein Sequence MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0250-Ab Anti-GUC2B/ GUCA2B/ GCAP-II functional antibody
    Target Antigen GM-Tg-g-SE0250-Ag GUCA2B protein
    ORF Viral Vector pGMLP005002 Human GUCA2B Lentivirus plasmid
    ORF Viral Vector vGMLP005002 Human GUCA2B Lentivirus particle


    Target information

    Target ID GM-SE0250
    Target Name GUCA2B
    Gene ID 2981, 14916, 699525, 64055, 101092381, 100684829, 515664, 100067585
    Gene Symbol and Synonyms GCAP-II,Gcap2,GUCA2B,UGN
    Uniprot Accession Q16661
    Uniprot Entry Name GUC2B_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Malignant neoplasm of bladder
    Gene Ensembl ENSG00000044012
    Target Classification Not Available

    This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.