Human GUCA2B/GCAP-II/UGN ORF/cDNA clone-Lentivirus plasmid (NM_007102)
Cat. No.: pGMLP005002
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GUCA2B/GCAP-II/UGN Lentiviral expression plasmid for GUCA2B lentivirus packaging, GUCA2B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GUCA2B/GCAP-II products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005002 |
Gene Name | GUCA2B |
Accession Number | NM_007102 |
Gene ID | 2981 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 339 bp |
Gene Alias | GCAP-II,UGN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCTGCAGGGCTGCATCAGGGCTCCTGCCAGGAGTGGCCGTGGTCCTCCTGCTGCTGCTGCAGAGCACACAGTCAGTCTACATCCAGTACCAAGGCTTCCGGGTCCAGCTGGAATCCATGAAGAAGCTGAGTGACCTGGAGGCACAGTGGGCACCCAGCCCCCGCCTGCAGGCCCAGAGCCTCCTGCCCGCCGTGTGCCACCACCCTGCTCTGCCTCAGGACCTTCAGCCTGTCTGCGCCTCGCAGGAGGCTTCCAGCATCTTCAAGACCCTGAGGACCATCGCTAACGACGACTGTGAGCTGTGTGTGAACGTTGCGTGTACCGGCTGCCTCTGA |
ORF Protein Sequence | MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0250-Ab | Anti-GUC2B/ GUCA2B/ GCAP-II functional antibody |
Target Antigen | GM-Tg-g-SE0250-Ag | GUCA2B protein |
ORF Viral Vector | pGMLP005002 | Human GUCA2B Lentivirus plasmid |
ORF Viral Vector | vGMLP005002 | Human GUCA2B Lentivirus particle |
Target information
Target ID | GM-SE0250 |
Target Name | GUCA2B |
Gene ID | 2981, 14916, 699525, 64055, 101092381, 100684829, 515664, 100067585 |
Gene Symbol and Synonyms | GCAP-II,Gcap2,GUCA2B,UGN |
Uniprot Accession | Q16661 |
Uniprot Entry Name | GUC2B_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000044012 |
Target Classification | Not Available |
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.