Human GAP43/B-50/PP46 ORF/cDNA clone-Lentivirus particle (NM_002045)

Cat. No.: vGMLP004662

Pre-made Human GAP43/B-50/PP46 Lentiviral expression plasmid for GAP43 lentivirus packaging, GAP43 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GAP43/B-50 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004662 Human GAP43 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004662
Gene Name GAP43
Accession Number NM_002045
Gene ID 2596
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 717 bp
Gene Alias B-50,PP46
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGTGCTGTATGAGAAGAACCAAACAGGTTGAAAAAAATGATGACGACCAAAAGATTGAACAAGATGGTATCAAACCAGAAGATAAAGCTCATAAGGCCGCAACCAAAATTCAGGCTAGCTTCCGTGGACACATAACAAGGAAAAAGCTCAAAGGAGAGAAGAAGGATGATGTCCAAGCTGCTGAGGCTGAAGCTAATAAGAAGGATGAAGCCCCTGTTGCCGATGGGGTGGAGAAGAAGGGAGAAGGCACCACTACTGCCGAAGCAGCCCCAGCCACTGGCTCCAAGCCTGATGAGCCCGGCAAAGCAGGAGAAACTCCTTCCGAGGAGAAGAAGGGGGAGGGTGATGCTGCCACAGAGCAGGCAGCCCCCCAGGCTCCTGCATCCTCAGAGGAGAAGGCCGGCTCAGCTGAGACAGAAAGTGCCACTAAAGCTTCCACTGATAACTCGCCGTCCTCCAAGGCTGAAGATGCCCCAGCCAAGGAGGAGCCTAAACAAGCCGATGTGCCTGCTGCTGTCACTGCTGCTGCTGCCACCACCCCTGCCGCAGAGGATGCTGCTGCCAAGGCAACAGCCCAGCCTCCAACGGAGACTGGGGAGAGCAGCCAAGCTGAAGAGAACATAGAAGCTGTAGATGAAACCAAACCTAAGGAAAGTGCCCGGCAGGACGAGGGTAAAGAAGAGGAACCTGAGGCTGACCAAGAACATGCCTGA
ORF Protein Sequence MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93966-Ab Anti-NEUM/ GAP43/ B-50 monoclonal antibody
    Target Antigen GM-Tg-g-T93966-Ag GAP43 VLP (virus-like particle)
    ORF Viral Vector pGMLP004662 Human GAP43 Lentivirus plasmid
    ORF Viral Vector pGMLV000306 Human GAP43 Lentivirus plasmid
    ORF Viral Vector vGMLP004662 Human GAP43 Lentivirus particle
    ORF Viral Vector vGMLV000306 Human GAP43 Lentivirus particle


    Target information

    Target ID GM-T93966
    Target Name GAP43
    Gene ID 2596, 14432, 711260, 29423, 493873, 478572, 281777, 100061125
    Gene Symbol and Synonyms B-50,Basp2,GAP-43,GAP43,PP46
    Uniprot Accession P17677
    Uniprot Entry Name NEUM_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000172020
    Target Classification Not Available

    The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.