Human MDK/MK ORF/cDNA clone-Adenovirus particle (BC011704)
Cat. No.: vGMAP000465
Pre-made Human MDK/MK Adenovirus for MDK overexpression in-vitro and in-vivo. The MDK adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified MDK-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
Midkine/MDK/MK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP000465 | Human MDK Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP000465 |
Gene Name | MDK |
Accession Number | BC011704 |
Gene ID | 4192 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 432 bp |
Gene Alias | MK |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGCACCGAGGCTTCCTCCTCCTCACCCTCCTCGCCCTGCTGGCGCTCACCTCCGCGGTCGCCAAAAAGAAAGATAAGGTGAAGAAGGGCGGCCCGGGGAGCGAGTGCGCTGAGTGGGCCTGGGGGCCCTGCACCCCCAGCAGCAAGGATTGCGGCGTGGGTTTCCGCGAGGGCACCTGCGGGGCCCAGACCCAGCGCATCCGGTGCAGGGTGCCCTGCAACTGGAAGAAGGAGTTTGGAGCCGACTGCAAGTACAAGTTTGAGAACTGGGGTGCGTGTGATGGGGGCACAGGCACCAAAGTCCGCCAAGGCACCCTGAAGAAGGCGCGCTACAATGCTCAGTGCCAGGAGACCATCCGCGTCACCAAGCCCTGCACCCCCAAGACCAAAGCAAAGGCCAAAGCCAAGAAAGGGAAGGGAAAGGACTAG |
ORF Protein Sequence | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T03878-Ab | Anti-MK/ Midkine/ MDK functional antibody |
Target Antigen | GM-Tg-g-T03878-Ag | Midkine/MDK protein |
ORF Viral Vector | pGMLP000499 | Human MDK Lentivirus plasmid |
ORF Viral Vector | pGMAD001596 | Human MDK Adenovirus plasmid |
ORF Viral Vector | pGMAP000446 | Human MDK Adenovirus plasmid |
ORF Viral Vector | pGMAP000465 | Human MDK Adenovirus plasmid |
ORF Viral Vector | vGMLP000499 | Human MDK Lentivirus particle |
ORF Viral Vector | vGMAD001596 | Human MDK Adenovirus particle |
ORF Viral Vector | vGMAP000446 | Human MDK Adenovirus particle |
ORF Viral Vector | vGMAP000465 | Human MDK Adenovirus particle |
Target information
Target ID | GM-T03878 |
Target Name | Midkine |
Gene ID | 4192, 17242, 714591, 81517, 101087941, 119864230, 280852, 100147284 |
Gene Symbol and Synonyms | ARAP,MDK,Mek,MK,NEGF2 |
Uniprot Accession | P21741 |
Uniprot Entry Name | MK_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Lung Cancer, Malignant neoplasm of bladder, Urinary bladder urothelial carcinoma, breast cancer |
Gene Ensembl | ENSG00000110492 |
Target Classification | Not Available |
This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.