Human CGA/CG-ALPHA/FSHA ORF/cDNA clone-Adenovirus particle (BC020782)

Cat. No.: vGMAP000267

Pre-made Human CGA/CG-ALPHA/FSHA Adenovirus for CGA overexpression in-vitro and in-vivo. The CGA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CGA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CGA/CG-ALPHA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000267 Human CGA Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000267
Gene Name CGA
Accession Number BC020782
Gene ID 1081
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 351 bp
Gene Alias CG-ALPHA,FSHA,GPHa,GPHA1,HCG,LHA,TSHA
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCATGTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCATTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCATATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAGTCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTGGAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAA
ORF Protein Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16650-Ab Anti-GLHA/ CGA/ CG-ALPHA functional antibody
    Target Antigen GM-Tg-g-T16650-Ag CGA protein
    ORF Viral Vector pGMAP000121 Human CGA Adenovirus plasmid
    ORF Viral Vector pGMAP000267 Human CGA Adenovirus plasmid
    ORF Viral Vector vGMAP000121 Human CGA Adenovirus particle
    ORF Viral Vector vGMAP000267 Human CGA Adenovirus particle


    Target information

    Target ID GM-T16650
    Target Name CGA
    Gene ID 1081, 12640, 697859, 116700, 751819, 403483, 280749, 100034174
    Gene Symbol and Synonyms aGSU,alpha-GSU,alphaGSU,alphaSU,CG,CG-ALPHA,CGA,FSH-alpha,FSHA,GPA1,GPHa,GPHA1,GPHalpha,HCG,LHA,LSH-alpha,TSH-alpha,TSHA
    Uniprot Accession P01215
    Uniprot Entry Name GLHA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Drug Abuse
    Gene Ensembl ENSG00000135346
    Target Classification Not Available

    The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.