Human IL31/IL-31 ORF/cDNA clone-Adenovirus particle (NM_001014336)

Cat. No.: vGMAP-IL-118

Pre-made Human IL31/IL-31 Adenovirus for IL31 overexpression in-vitro and in-vivo. The IL31 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL31-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL31/IL-31 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-118 Human IL31 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-118
Gene Name IL31
Accession Number NM_001014336
Gene ID 386653
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 495 bp
Gene Alias IL-31
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCCTCTCACTCAGGCCCCTCGACGTCTGTGCTCTTTCTGTTCTGCTGCCTGGGAGGCTGGCTGGCCTCCCACACGTTGCCCGTCCGTTTACTACGACCAAGTGATGATGTACAGAAAATAGTCGAGGAATTACAGTCCCTCTCGAAGATGCTTTTGAAAGATGTGGAGGAAGAGAAGGGCGTGCTCGTGTCCCAGAATTACACGCTGCCGTGTCTCAGCCCTGACGCCCAGCCGCCAAACAACATCCACAGCCCAGCCATCCGGGCATATCTCAAGACAATCAGACAGCTAGACAACAAATCTGTTATTGATGAGATCATAGAGCACCTCGACAAACTCATATTTCAAGATGCACCAGAAACAAACATTTCTGTGCCAACAGACACCCATGAATGTAAACGCTTCATCCTGACTATTTCTCAACAGTTTTCAGAGTGCATGGACCTCGCACTAAAATCATTGACCTCTGGAGCCCAACAGGCCACCACTTAA
ORF Protein Sequence MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-319 Pre-Made Lokivetmab biosimilar, Canine Whole Mab: Anti-IL31 therapeutic antibody
    Biosimilar GMP-Bios-ab-155 Pre-Made Dovanvetmab biosimilar, Feline Whole Mab: Anti-IL31 (Feline) therapeutic antibody
    Target Antibody GM-Tg-g-T11701-Ab Anti-IL31/ IL-31 functional antibody
    Target Antigen GM-Tg-g-T11701-Ag IL31 protein
    Cytokine cks-Tg-g-GM-T11701 interleukin 31 (Il31) protein & antibody
    ORF Viral Vector pGMLP004789 Human IL31 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-035 Human IL31 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-118 Human IL31 Adenovirus plasmid
    ORF Viral Vector vGMLP004789 Human IL31 Lentivirus particle
    ORF Viral Vector vGMLP-IL-035 Human IL31 Lentivirus particle
    ORF Viral Vector vGMAP-IL-118 Human IL31 Adenovirus particle


    Target information

    Target ID GM-T11701
    Target Name IL31
    Gene ID 386653, 76399, 701655, 690028, 105261056, 100302725, 102149194
    Gene Symbol and Synonyms 1700013B14Rik,AABR07036324.1,IL-31,IL31
    Uniprot Accession Q6EBC2
    Uniprot Entry Name IL31_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000204671
    Target Classification Not Available

    IL31, which is made principally by activated Th2-type T cells, interacts with a heterodimeric receptor consisting of IL31RA (MIM 609510) and OSMR (MIM 601743) that is constitutively expressed on epithelial cells and keratinocytes. IL31 may be involved in the promotion of allergic skin disorders and in regulating other allergic diseases, such as asthma (Dillon et al., 2004 [PubMed 15184896]).[supplied by OMIM, Mar 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.