Human IL31/IL-31 ORF/cDNA clone-Adenovirus particle (NM_001014336)
Cat. No.: vGMAP-IL-118
Pre-made Human IL31/IL-31 Adenovirus for IL31 overexpression in-vitro and in-vivo. The IL31 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL31-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
IL31/IL-31 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP-IL-118 | Human IL31 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP-IL-118 |
Gene Name | IL31 |
Accession Number | NM_001014336 |
Gene ID | 386653 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 495 bp |
Gene Alias | IL-31 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGCCTCTCACTCAGGCCCCTCGACGTCTGTGCTCTTTCTGTTCTGCTGCCTGGGAGGCTGGCTGGCCTCCCACACGTTGCCCGTCCGTTTACTACGACCAAGTGATGATGTACAGAAAATAGTCGAGGAATTACAGTCCCTCTCGAAGATGCTTTTGAAAGATGTGGAGGAAGAGAAGGGCGTGCTCGTGTCCCAGAATTACACGCTGCCGTGTCTCAGCCCTGACGCCCAGCCGCCAAACAACATCCACAGCCCAGCCATCCGGGCATATCTCAAGACAATCAGACAGCTAGACAACAAATCTGTTATTGATGAGATCATAGAGCACCTCGACAAACTCATATTTCAAGATGCACCAGAAACAAACATTTCTGTGCCAACAGACACCCATGAATGTAAACGCTTCATCCTGACTATTTCTCAACAGTTTTCAGAGTGCATGGACCTCGCACTAAAATCATTGACCTCTGGAGCCCAACAGGCCACCACTTAA |
ORF Protein Sequence | MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-319 | Pre-Made Lokivetmab biosimilar, Canine Whole Mab: Anti-IL31 therapeutic antibody |
Biosimilar | GMP-Bios-ab-155 | Pre-Made Dovanvetmab biosimilar, Feline Whole Mab: Anti-IL31 (Feline) therapeutic antibody |
Target Antibody | GM-Tg-g-T11701-Ab | Anti-IL31/ IL-31 functional antibody |
Target Antigen | GM-Tg-g-T11701-Ag | IL31 protein |
Cytokine | cks-Tg-g-GM-T11701 | interleukin 31 (Il31) protein & antibody |
ORF Viral Vector | pGMLP004789 | Human IL31 Lentivirus plasmid |
ORF Viral Vector | pGMLP-IL-035 | Human IL31 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-118 | Human IL31 Adenovirus plasmid |
ORF Viral Vector | vGMLP004789 | Human IL31 Lentivirus particle |
ORF Viral Vector | vGMLP-IL-035 | Human IL31 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-118 | Human IL31 Adenovirus particle |
Target information
Target ID | GM-T11701 |
Target Name | IL31 |
Gene ID | 386653, 76399, 701655, 690028, 105261056, 100302725, 102149194 |
Gene Symbol and Synonyms | 1700013B14Rik,AABR07036324.1,IL-31,IL31 |
Uniprot Accession | Q6EBC2 |
Uniprot Entry Name | IL31_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000204671 |
Target Classification | Not Available |
IL31, which is made principally by activated Th2-type T cells, interacts with a heterodimeric receptor consisting of IL31RA (MIM 609510) and OSMR (MIM 601743) that is constitutively expressed on epithelial cells and keratinocytes. IL31 may be involved in the promotion of allergic skin disorders and in regulating other allergic diseases, such as asthma (Dillon et al., 2004 [PubMed 15184896]).[supplied by OMIM, Mar 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.