Human IL3/IL-3/MCGF ORF/cDNA clone-Adenovirus particle (NM_000588)

Cat. No.: vGMAP-IL-089

Pre-made Human IL3/IL-3/MCGF Adenovirus for IL3 overexpression in-vitro and in-vivo. The IL3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL3/IL-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-089 Human IL3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-089
Gene Name IL3
Accession Number NM_000588
Gene ID 3562
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 459 bp
Gene Alias IL-3,MCGF,MULTI-CSF
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCTCCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGATGAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCGCAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTGA
ORF Protein Sequence MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1027-Ab Anti-IL3/ IL-3/ MCGF functional antibody
    Target Antigen GM-Tg-g-SE1027-Ag IL3 protein
    ORF Viral Vector pGMLP000459 Human IL3 Lentivirus plasmid
    ORF Viral Vector pGMAP000287 Human IL3 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-006 Human IL3 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-089 Human IL3 Adenovirus plasmid
    ORF Viral Vector vGMLP000459 Human IL3 Lentivirus particle
    ORF Viral Vector vGMAP000287 Human IL3 Adenovirus particle
    ORF Viral Vector vGMLP-IL-006 Human IL3 Lentivirus particle
    ORF Viral Vector vGMAP-IL-089 Human IL3 Adenovirus particle


    Target information

    Target ID GM-SE1027
    Target Name IL3
    Gene ID 3562, 16187, 706946, 24495, 481497, 280823
    Gene Symbol and Synonyms BPA,Csfmu,HCGF,IL-3,IL3,MCGF,MULTI-CSF,PSF
    Uniprot Accession P08700
    Uniprot Entry Name IL3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164399
    Target Classification Not Available

    The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.