Human IL3/IL-3/MCGF ORF/cDNA clone-Adenovirus plasmid (BC069472)
Cat. No.: pGMAP000287
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL3/IL-3/MCGF adenoviral expression plasmid for IL3 adenovirus packaging, IL3 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL3/IL-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000287 |
Gene Name | IL3 |
Accession Number | BC069472 |
Gene ID | 3562 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 459 bp |
Gene Alias | IL-3,MCGF,MULTI-CSF |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCTCCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGATGAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCGCAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTGA |
ORF Protein Sequence | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1027-Ab | Anti-IL3/ IL-3/ MCGF functional antibody |
Target Antigen | GM-Tg-g-SE1027-Ag | IL3 protein |
ORF Viral Vector | pGMLP000459 | Human IL3 Lentivirus plasmid |
ORF Viral Vector | pGMAP000287 | Human IL3 Adenovirus plasmid |
ORF Viral Vector | pGMLP-IL-006 | Human IL3 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-089 | Human IL3 Adenovirus plasmid |
ORF Viral Vector | vGMLP000459 | Human IL3 Lentivirus particle |
ORF Viral Vector | vGMAP000287 | Human IL3 Adenovirus particle |
ORF Viral Vector | vGMLP-IL-006 | Human IL3 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-089 | Human IL3 Adenovirus particle |
Target information
Target ID | GM-SE1027 |
Target Name | IL3 |
Gene ID | 3562, 16187, 706946, 24495, 481497, 280823 |
Gene Symbol and Synonyms | BPA,Csfmu,HCGF,IL-3,IL3,MCGF,MULTI-CSF,PSF |
Uniprot Accession | P08700 |
Uniprot Entry Name | IL3_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000164399 |
Target Classification | Not Available |
The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.