Human CXCL6/CKA-3/GCP-2 ORF/cDNA clone-Adenovirus particle (NM_002993)
Cat. No.: vGMAD001587
Pre-made Human CXCL6/CKA-3/GCP-2 Adenovirus for CXCL6 overexpression in-vitro and in-vivo. The CXCL6 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CXCL6-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CXCL6/CKA-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD001587 | Human CXCL6 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD001587 |
Gene Name | CXCL6 |
Accession Number | NM_002993 |
Gene ID | 6372 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 345 bp |
Gene Alias | CKA-3,GCP-2,GCP2,SCYB6 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGAGCCTCCCGTCCAGCCGCGCGGCCCGTGTCCCGGGTCCTTCGGGCTCCTTGTGCGCGCTGCTCGCGCTGCTGCTCCTGCTGACGCCGCCGGGGCCCCTCGCCAGCGCTGGTCCTGTCTCTGCTGTGCTGACAGAGCTGCGTTGCACTTGTTTACGCGTTACGCTGAGAGTAAACCCCAAAACGATTGGTAAACTGCAGGTGTTCCCCGCAGGCCCGCAGTGCTCCAAGGTGGAAGTGGTAGCCTCCCTGAAGAACGGGAAGCAAGTTTGTCTGGACCCGGAAGCCCCTTTTCTAAAGAAAGTCATCCAGAAAATTTTGGACAGTGGAAACAAGAAAAACTGA |
ORF Protein Sequence | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0845-Ab | Anti-CXCL6/ CKA-3/ GCP-2 functional antibody |
Target Antigen | GM-Tg-g-SE0845-Ag | CXCL6 protein |
Cytokine | cks-Tg-g-GM-SE0845 | chemokine (C-X-C motif) ligand 6 (CXCL6) protein & antibody |
ORF Viral Vector | pGMLP002324 | Human CXCL6 Lentivirus plasmid |
ORF Viral Vector | pGMAD001587 | Human CXCL6 Adenovirus plasmid |
ORF Viral Vector | vGMLP002324 | Human CXCL6 Lentivirus particle |
ORF Viral Vector | vGMAD001587 | Human CXCL6 Adenovirus particle |
Target information
Target ID | GM-SE0845 |
Target Name | CXCL6 |
Gene ID | 6372, 704133, 100033988 |
Gene Symbol and Synonyms | CKA-3,CXCL6,GCP-2,GCP2,SCYB6 |
Uniprot Accession | P80162 |
Uniprot Entry Name | CXCL6_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000124875 |
Target Classification | Not Available |
The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, Jun 2020]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.