Human CXCL6/CKA-3/GCP-2 ORF/cDNA clone-Lentivirus plasmid (NM_002993)
Cat. No.: pGMLP002324
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CXCL6/CKA-3/GCP-2 Lentiviral expression plasmid for CXCL6 lentivirus packaging, CXCL6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CXCL6/CKA-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002324 |
Gene Name | CXCL6 |
Accession Number | NM_002993 |
Gene ID | 6372 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 345 bp |
Gene Alias | CKA-3,GCP-2,GCP2,SCYB6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGCCTCCCGTCCAGCCGCGCGGCCCGTGTCCCGGGTCCTTCGGGCTCCTTGTGCGCGCTGCTCGCGCTGCTGCTCCTGCTGACGCCGCCGGGGCCCCTCGCCAGCGCTGGTCCTGTCTCTGCTGTGCTGACAGAGCTGCGTTGCACTTGTTTACGCGTTACGCTGAGAGTAAACCCCAAAACGATTGGTAAACTGCAGGTGTTCCCCGCAGGCCCGCAGTGCTCCAAGGTGGAAGTGGTAGCCTCCCTGAAGAACGGGAAGCAAGTTTGTCTGGACCCGGAAGCCCCTTTTCTAAAGAAAGTCATCCAGAAAATTTTGGACAGTGGAAACAAGAAAAACTGA |
ORF Protein Sequence | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0845-Ab | Anti-CXCL6/ CKA-3/ GCP-2 functional antibody |
Target Antigen | GM-Tg-g-SE0845-Ag | CXCL6 protein |
Cytokine | cks-Tg-g-GM-SE0845 | chemokine (C-X-C motif) ligand 6 (CXCL6) protein & antibody |
ORF Viral Vector | pGMLP002324 | Human CXCL6 Lentivirus plasmid |
ORF Viral Vector | pGMAD001587 | Human CXCL6 Adenovirus plasmid |
ORF Viral Vector | vGMLP002324 | Human CXCL6 Lentivirus particle |
ORF Viral Vector | vGMAD001587 | Human CXCL6 Adenovirus particle |
Target information
Target ID | GM-SE0845 |
Target Name | CXCL6 |
Gene ID | 6372, 704133, 100033988 |
Gene Symbol and Synonyms | CKA-3,CXCL6,GCP-2,GCP2,SCYB6 |
Uniprot Accession | P80162 |
Uniprot Entry Name | CXCL6_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000124875 |
Target Classification | Not Available |
The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, Jun 2020]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.