Human AGR2/AG-2/AG2 ORF/cDNA clone-Adenovirus particle (NM_006408.4)

Cat. No.: vGMAD001490

Pre-made Human AGR2/AG-2/AG2 Adenovirus for AGR2 overexpression in-vitro and in-vivo. The AGR2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified AGR2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to AG-2/AGR2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD001490 Human AGR2 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD001490
Gene Name AGR2
Accession Number NM_006408.4
Gene ID 10551
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 528 bp
Gene Alias AG-2,AG2,GOB-4,HAG-2,HEL-S-116,HPC8,PDIA17,RIFTD,XAG-2
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCACAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGGTTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAACCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGATATCACTGGAAGATATTCAAATCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACATGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTGTAA
ORF Protein Sequence MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T34352-Ab Anti-AGR2/ AG-2/ AG2 functional antibody
    Target Antigen GM-Tg-g-T34352-Ag AG-2/AGR2 protein
    ORF Viral Vector pGMLV001303 Human AGR2 Lentivirus plasmid
    ORF Viral Vector pGMAD001490 Human AGR2 Adenovirus plasmid
    ORF Viral Vector pGMAP000150 Human AGR2 Adenovirus plasmid
    ORF Viral Vector vGMLV001303 Human AGR2 Lentivirus particle
    ORF Viral Vector vGMAD001490 Human AGR2 Adenovirus particle
    ORF Viral Vector vGMAP000150 Human AGR2 Adenovirus particle


    Target information

    Target ID GM-T34352
    Target Name AG-2
    Gene ID 10551, 23795, 709127, 298961, 101084694, 482333, 415112, 100053075
    Gene Symbol and Synonyms AG-2,AG2,AGR2,Agr2h,GOB-4,HAG-2,HEL-S-116,HPC8,mAG-2,PDIA17,RIFTD,XAG-2
    Uniprot Accession O95994
    Uniprot Entry Name AGR2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Prostate Cancer, Malignant neoplasm of prostate
    Gene Ensembl ENSG00000106541
    Target Classification Not Available

    This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.