Human TNF/DIF/TNF-alpha ORF/cDNA clone-Adenovirus particle (NM_000594)

Cat. No.: vGMAD000416

Pre-made Human TNF/DIF/TNF-alpha Adenovirus for TNF overexpression in-vitro and in-vivo. The TNF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TNF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TNF/DIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000416 Human TNF Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000416
Gene Name TNF
Accession Number NM_000594
Gene ID 7124
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 702 bp
Gene Alias DIF,TNF-alpha,TNFA,TNFSF2,TNLG1F
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAAGAAGACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCAGCCTCTTCTCCTTCCTGATCGTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCCCCCAGAGGGAAGAGTTCCCCAGGGACCTCTCTCTAATCAGCCCTCTGGCCCAGGCAGTCAGATCATCTTCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTCAAGCTGAGGGGCAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATGGCGTGGAGCTGAGAGATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCATCTACTCCCAGGTCCTCTTCAAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGTCAACCTCCTCTCTGCCATCAAGAGCCCCTGCCAGAGGGAGACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCCCATCTATCTGGGAGGGGTCTTCCAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATCAATCGGCCCGACTATCTCGACTTTGCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGCCCTGTGA
ORF Protein Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-478 Pre-Made Remtolumab biosimilar, Bispecific Dual Variable Domain IG: Anti-IL17A/IL17;TNFA/TNF therapeutic antibody
    Biosimilar GMP-Bios-INN-846 Pre-Made Etanercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-ab-445 Pre-Made Placulumab biosimilar, Single Domain Variable Fragment (VL + Fc), Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-249 Pre-Made Golimumab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-887 Pre-Made Lenercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-INN-935 Pre-Made Onercept Biosimilar, Recombinant Protein targeting TNF: Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-INN-927 Pre-Made Nerelimomab Biosimilar, Whole Mab, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-721 Pre-Made Afelimomab Biosimilar, Fab Fusion, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-310 Pre-Made Licaminlimab biosimilar, scFv, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-009 Pre-Made Adalimumab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-718 Pre-Made Adalimumab Beta Biosimilar, Whole Mab, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-1036 Pre-Made Tulinercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-ab-274 Pre-Made Infliximab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-419 Pre-Made Ozoralizumab biosimilar, Bispecific Single Domains (VH-VH'-VH), Anti-TNFA/TNF;ALB Antibody: Anti-DIF/TNF-alpha/TNFSF2/TNLG1F;FDAHT/HSA/PRO0883/PRO0903/PRO1341 therapeutic antibody
    Biosimilar GMP-Bios-ab-100 Pre-Made Certolizumab biosimilar, Fab, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-938 Pre-Made Opinercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Target Antibody GM-Tg-g-T20178-Ab Anti-TNFA/ TNF/ DIF-alpha monoclonal antibody
    Target Antigen GM-Tg-g-T20178-Ag TNF VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T20178 Tumor necrosis factor (TNF) protein & antibody
    ORF Viral Vector pGMAD000017 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMAD000416 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMAP000307 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMPC004774 Human TNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAD000017 Human TNF Adenovirus particle
    ORF Viral Vector vGMAD000416 Human TNF Adenovirus particle
    ORF Viral Vector vGMAP000307 Human TNF Adenovirus particle


    Target information

    Target ID GM-T20178
    Target Name TNF
    Gene ID 7124, 21926, 715467, 24835, 493755, 403922, 280943, 100033834
    Gene Symbol and Synonyms cTNF,DIF,RATTNF,TNF,TNF-a,TNF-alpha,TNFA,TNFalpha,Tnfsf1a,TNFSF2,TNLG1F
    Uniprot Accession P01375
    Uniprot Entry Name TNFA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Ovary Cancer, toluene diisocyanate asthma, Giant Cell Arteritis, Polymyalgia Rheumatica, Chronic Kidney Disease, Dent disease, Hodgkin's disease, Kidney transplant rejection, pancreatic cancer, Chronic Glomerulonephritis, Asthma
    Gene Ensembl ENSG00000232810
    Target Classification Checkpoint-Immuno Oncology

    This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Aug 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.