Human IGF1/IGF-I/IGF1A ORF/cDNA clone-Adenovirus particle (NM_001111283.1)

Cat. No.: vGMAD000056

Pre-made Human IGF1/IGF-I/IGF1A Adenovirus for IGF1 overexpression in-vitro and in-vivo. The IGF1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IGF1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IGF1/IGF-I products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000056 Human IGF1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000056
Gene Name IGF1
Accession Number NM_001111283.1
Gene ID 3479
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 477 bp
Gene Alias IGF-I,IGF1A,IGFI
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGTATCAGCCCCCATCTACCAACAAGAACACGAAGTCTCAGAGAAGGAAAGGAAGTACATTTGAAGAACGCAAGTAG
ORF Protein Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEERK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-634 Pre-Made Xentuzumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Biosimilar GMP-Bios-ab-160 Pre-Made Dusigitumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Target Antibody GM-Tg-g-T60930-Ab Anti-IGF1/ IGF/ IGF-I functional antibody
    Target Antigen GM-Tg-g-T60930-Ag IGF1 protein
    Cytokine cks-Tg-g-GM-T60930 insulin-like growth factor 1 (IGF1) protein & antibody
    ORF Viral Vector pGMLP003306 Human IGF1 Lentivirus plasmid
    ORF Viral Vector pGMLV000664 Human IGF-1 Lentivirus plasmid
    ORF Viral Vector pGMAD000056 Human IGF1 Adenovirus plasmid
    ORF Viral Vector pGMAAV001559 Human IGF1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003306 Human IGF1 Lentivirus particle
    ORF Viral Vector vGMLV000664 Human IGF-1 Lentivirus particle
    ORF Viral Vector vGMAD000056 Human IGF1 Adenovirus particle
    ORF Viral Vector vGMAAV001559 Human IGF1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T60930
    Target Name IGF1
    Gene ID 3479, 16000, 698444, 24482, 101101237, 610255, 281239, 100034198
    Gene Symbol and Synonyms C730016P09Rik,IGF,Igf-1,IGF-I,IGF1,IGFI,IGFIA,MGF
    Uniprot Accession P05019
    Uniprot Entry Name IGF1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000017427
    Target Classification Not Available

    The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.