Human IGF-1/IGF/IGF-I ORF/cDNA clone-Lentivirus plasmid (NM_001111283)

Cat. No.: pGMLV000664
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IGF-1/IGF/IGF-I Lentiviral expression plasmid for IGF-1 lentivirus packaging, IGF-1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IGF1/IGF-1/IGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000664
Gene Name IGF-1
Accession Number NM_001111283
Gene ID 3479
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 477 bp
Gene Alias IGF,IGF-I,IGFI,MGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGTATCAGCCCCCATCTACCAACAAGAACACGAAGTCTCAGAGAAGGAAAGGAAGTACATTTGAAGAACGCAAGTAG
ORF Protein Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEERK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-634 Pre-Made Xentuzumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Biosimilar GMP-Bios-ab-160 Pre-Made Dusigitumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Target Antibody GM-Tg-g-T60930-Ab Anti-IGF1/ IGF/ IGF-I functional antibody
    Target Antigen GM-Tg-g-T60930-Ag IGF1 protein
    Cytokine cks-Tg-g-GM-T60930 insulin-like growth factor 1 (IGF1) protein & antibody
    ORF Viral Vector pGMLP003306 Human IGF1 Lentivirus plasmid
    ORF Viral Vector pGMLV000664 Human IGF-1 Lentivirus plasmid
    ORF Viral Vector pGMAD000056 Human IGF1 Adenovirus plasmid
    ORF Viral Vector pGMAAV001559 Human IGF1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003306 Human IGF1 Lentivirus particle
    ORF Viral Vector vGMLV000664 Human IGF-1 Lentivirus particle
    ORF Viral Vector vGMAD000056 Human IGF1 Adenovirus particle
    ORF Viral Vector vGMAAV001559 Human IGF1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T60930
    Target Name IGF1
    Gene ID 3479, 16000, 698444, 24482, 101101237, 610255, 281239, 100034198
    Gene Symbol and Synonyms C730016P09Rik,IGF,Igf-1,IGF-I,IGF1,IGFI,IGFIA,MGF
    Uniprot Accession P05019
    Uniprot Entry Name IGF1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000017427
    Target Classification Not Available

    The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.