Human PFN2/D3S1319E/PFL ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_053024.4)
Cat. No.: pGMPC001399
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PFN2/D3S1319E/PFL Non-Viral expression plasmid (overexpression vector) for mouse PFN2 overexpression in unique cell transient transfection and stable cell line development.
Go to
PFN2/D3S1319E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001399 |
Gene Name | PFN2 |
Accession Number | NM_053024.4 |
Gene ID | 5217 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 423 bp |
Gene Alias | D3S1319E,PFL |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCCGCCATTGTCGGCTACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTTCAGAGCATTACGCCAATAGAAATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTTACCAACGGTTTGACTCTTGGCGCGAAGAAATGCTCAGTGATCAGAGATAGTCTATACGTCGATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAGGTGGGGAGCCAACATACAATGTGGCTGTCGGCAGAGCTGGTAGAGTCTTGGTCTTTGTAATGGGAAAAGAAGGGGTCCATGGAGGCGGATTGAATAAGAAGGCATACTCAATGGCAAAATACTTGAGAGACTCTGGGTTCTAG |
ORF Protein Sequence | MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1377-Ab | Anti-PFN2 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1377-Ag | PFN2 protein |
ORF Viral Vector | pGMPC000545 | Human PFN2 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001399 | Human PFN2 Mammalian (Non-Viral Vector) plasmid |
Target information
Target ID | GM-IP1377 |
Target Name | PFN2 |
Gene ID | 5217, 18645, 713460, 81531, 101099994, 100683352, 539034, 100630364 |
Gene Symbol and Synonyms | D3S1319E,PFL,Pfn,PFN2 |
Uniprot Accession | P35080 |
Uniprot Entry Name | PROF2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000070087 |
Target Classification | Not Available |
The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.