Human PFN2/D3S1319E/PFL ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_053024.4)

Cat. No.: pGMPC000545
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PFN2/D3S1319E/PFL Non-Viral expression plasmid (overexpression vector) for mouse PFN2 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PFN2/D3S1319E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000545
Gene Name PFN2
Accession Number NM_053024.4
Gene ID 5217
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 423 bp
Gene Alias D3S1319E,PFL
Fluorescent Reporter Renilla luciferase-Firefly luciferase
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCCGCCATTGTCGGCTACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTTCAGAGCATTACGCCAATAGAAATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTTACCAACGGTTTGACTCTTGGCGCGAAGAAATGCTCAGTGATCAGAGATAGTCTATACGTCGATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAGGTGGGGAGCCAACATACAATGTGGCTGTCGGCAGAGCTGGTAGAGTCTTGGTCTTTGTAATGGGAAAAGAAGGGGTCCATGGAGGCGGATTGAATAAGAAGGCATACTCAATGGCAAAATACTTGAGAGACTCTGGGTTCTAG
ORF Protein Sequence MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1377-Ab Anti-PFN2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1377-Ag PFN2 protein
    ORF Viral Vector pGMPC000545 Human PFN2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001399 Human PFN2 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP1377
    Target Name PFN2
    Gene ID 5217, 18645, 713460, 81531, 101099994, 100683352, 539034, 100630364
    Gene Symbol and Synonyms D3S1319E,PFL,Pfn,PFN2
    Uniprot Accession P35080
    Uniprot Entry Name PROF2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000070087
    Target Classification Not Available

    The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.