Human CXCL9/CMK/crg-10 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002416)
Cat. No.: pGMPC001262
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CXCL9/CMK/crg-10 Non-Viral expression plasmid (overexpression vector) for mouse CXCL9 overexpression in unique cell transient transfection and stable cell line development.
Go to
CXCL9/CMK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001262 |
Gene Name | CXCL9 |
Accession Number | NM_002416 |
Gene ID | 4283 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 378 bp |
Gene Alias | CMK,crg-10,Humig,MIG,SCYB9 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | Null |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGAAAAGTGGTGTTCTTTTCCTCTTGGGCATCATCTTGCTGGTTCTGATTGGAGTGCAAGGAACCCCAGTAGTGAGAAAGGGTCGCTGTTCCTGCATCAGCACCAACCAAGGGACTATCCACCTACAATCCTTGAAAGACCTTAAACAATTTGCCCCAAGCCCTTCCTGCGAGAAAATTGAAATCATTGCTACACTGAAGAATGGAGTTCAAACATGTCTAAACCCAGATTCAGCAGATGTGAAGGAACTGATTAAAAAGTGGGAGAAACAGGTCAGCCAAAAGAAAAAGCAAAAGAATGGGAAAAAACATCAAAAAAAGAAAGTTCTGAAAGTTCGAAAATCTCAACGTTCTCGTCAAAAGAAGACTACATAA |
ORF Protein Sequence | MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T56349-Ab | Anti-CXCL9/ CMK/ Humig functional antibody |
Target Antigen | GM-Tg-g-T56349-Ag | CXCL9 protein |
Cytokine | cks-Tg-g-GM-T56349 | chemokine (C-X-C motif) ligand 9 (CXCL9) protein & antibody |
ORF Viral Vector | pGMLP002749 | Human CXCL9 Lentivirus plasmid |
ORF Viral Vector | pGMPC001262 | Human CXCL9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002749 | Human CXCL9 Lentivirus particle |
Target information
Target ID | GM-T56349 |
Target Name | CXCL9 |
Gene ID | 4283, 17329, 574336, 246759, 101100388, 513990, 100057927 |
Gene Symbol and Synonyms | CMK,crg-10,CXCL9,Humig,MIG,MuMIG,SCYB9 |
Uniprot Accession | Q07325 |
Uniprot Entry Name | CXCL9_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
Disease | Hyperacute Allograft Rejection, Complications of kidney transplant, Kidney transplant rejection |
Gene Ensembl | ENSG00000138755 |
Target Classification | Checkpoint-Immuno Oncology |
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Aug 2020]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.