Human GREM2/CKTSF1B2/DAND3 ORF/cDNA clone-Lentivirus plasmid (NM_022469)
Cat. No.: pGMLP003417
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GREM2/CKTSF1B2/DAND3 Lentiviral expression plasmid for GREM2 lentivirus packaging, GREM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GREM2/CKTSF1B2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003417 |
Gene Name | GREM2 |
Accession Number | NM_022469 |
Gene ID | 64388 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 507 bp |
Gene Alias | CKTSF1B2,DAND3,PRDC,STHAG9 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTTCTGGAAGCTTTCCCTGTCCTTGTTCCTGGTGGCGGTGCTGGTGAAGGTGGCGGAAGCCCGGAAGAACCGGCCGGCGGGCGCCATCCCCTCGCCTTACAAGGACGGCAGCAGCAACAACTCGGAGAGATGGCAGCACCAGATCAAGGAGGTGCTGGCCTCCAGCCAGGAGGCCCTGGTGGTCACCGAGCGCAAGTACCTCAAGAGTGACTGGTGCAAGACGCAGCCGCTGCGGCAGACGGTGAGCGAGGAGGGCTGCCGGAGCCGCACCATCCTCAACCGCTTCTGCTACGGCCAGTGCAACTCCTTCTACATCCCGCGGCACGTGAAGAAGGAGGAGGAGTCCTTCCAGTCCTGCGCCTTCTGCAAGCCCCAGCGCGTCACCTCCGTCCTCGTGGAGCTCGAGTGCCCCGGCCTGGACCCACCCTTCCGACTCAAGAAAATCCAGAAGGTGAAGCAGTGCCGGTGCATGTCCGTGAACCTGAGCGACTCGGACAAGCAGTGA |
ORF Protein Sequence | MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0959-Ab | Anti-GREM2/ CKTSF1B2/ DAND3 functional antibody |
Target Antigen | GM-Tg-g-SE0959-Ag | GREM2 protein |
ORF Viral Vector | pGMLP003417 | Human GREM2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003417 | Human GREM2 Lentivirus particle |
Target information
Target ID | GM-SE0959 |
Target Name | GREM2 |
Gene ID | 64388, 23893, 708280, 289264, 101096531, 490367, 100060243 |
Gene Symbol and Synonyms | CKTSF1B2,DAND3,GREM2,Gremlin2,PRDC,RGD1560008,STHAG9 |
Uniprot Accession | Q9H772 |
Uniprot Entry Name | GREM2_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000180875 |
Target Classification | Not Available |
This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.