Human SMAD7/CRCS3/MADH7 ORF/cDNA clone-Lentivirus plasmid (NM_005904)
Cat. No.: pGMLP-SPh-049
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SMAD7/CRCS3/MADH7 Lentiviral expression plasmid for SMAD7 lentivirus packaging, SMAD7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SMAD7/CRCS3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP-SPh-049 |
Gene Name | SMAD7 |
Accession Number | NM_005904 |
Gene ID | 4092 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1281 bp |
Gene Alias | CRCS3,MADH7,MADH8 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTTCAGGACCAAACGATCTGCGCTCGTCCGGCGTCTCTGGAGGAGCCGTGCGCCCGGCGGCGAGGACGAGGAGGAGGGCGCAGGGGGAGGTGGAGGAGGAGGCGAGCTGCGGGGAGAAGGGGCGACGGACAGCCGAGCGCATGGGGCCGGTGGCGGCGGCCCGGGCAGGGCTGGATGCTGCCTGGGCAAGGCGGTGCGAGGTGCCAAAGGTCACCACCATCCCCACCCGCCAGCCGCGGGCGCCGGCGCGGCCGGGGGCGCCGAGGCGGATCTGAAGGCGCTCACGCACTCGGTGCTCAAGAAACTGAAGGAGCGGCAGCTGGAGCTGCTGCTCCAGGCCGTGGAGTCCCGCGGCGGGACGCGCACCGCGTGCCTCCTGCTGCCCGGCCGCCTGGACTGCAGGCTGGGCCCGGGGGCGCCCGCCGGCGCGCAGCCTGCGCAGCCGCCCTCGTCCTACTCGCTCCCCCTCCTGCTGTGCAAAGTGTTCAGGTGGCCGGATCTCAGGCATTCCTCGGAAGTCAAGAGGCTGTGTTGCTGTGAATCTTACGGGAAGATCAACCCCGAGCTGGTGTGCTGCAACCCCCATCACCTTAGCCGACTCTGCGAACTAGAGTCTCCCCCCCCTCCTTACTCCAGATACCCGATGGATTTTCTCAAACCAACTGCAGACTGTCCAGATGCTGTGCCTTCCTCCGCTGAAACAGGGGGAACGAATTATCTGGCCCCTGGGGGGCTTTCAGATTCCCAACTTCTTCTGGAGCCTGGGGATCGGTCACACTGGTGCGTGGTGGCATACTGGGAGGAGAAGACGAGAGTGGGGAGGCTCTACTGTGTCCAGGAGCCCTCTCTGGATATCTTCTATGATCTACCTCAGGGGAATGGCTTTTGCCTCGGACAGCTCAATTCGGACAACAAGAGTCAGCTGGTGCAGAAGGTGCGGAGCAAAATCGGCTGCGGCATCCAGCTGACGCGGGAGGTGGATGGTGTGTGGGTGTACAACCGCAGCAGTTACCCCATCTTCATCAAGTCCGCCACACTGGACAACCCGGACTCCAGGACGCTGTTGGTACACAAGGTGTTCCCCGGTTTCTCCATCAAGGCTTTCGACTACGAGAAGGCGTACAGCCTGCAGCGGCCCAATGACCACGAGTTTATGCAGCAGCCGTGGACGGGCTTTACCGTGCAGATCAGCTTTGTGAAGGGCTGGGGCCAGTGCTACACCCGCCAGTTCATCAGCAGCTGCCCGTGCTGGCTAGAGGTCATCTTCAACAGCCGGTAG |
ORF Protein Sequence | MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T94695-Ab | Anti-SMAD7 monoclonal antibody |
Target Antigen | GM-Tg-g-T94695-Ag | SMAD7 protein |
Cytokine | cks-Tg-g-GM-T94695 | SMAD family member 7 (SMAD7) protein & antibody |
ORF Viral Vector | pGMLP001429 | Human SMAD7 Lentivirus plasmid |
ORF Viral Vector | pGMLP-SPh-049 | Human SMAD7 Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-189 | Human SMAD7 Adenovirus plasmid |
ORF Viral Vector | pGMPC000433 | Human SMAD7 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP001429 | Human SMAD7 Lentivirus particle |
ORF Viral Vector | vGMLP-SPh-049 | Human SMAD7 Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-189 | Human SMAD7 Adenovirus particle |
Target information
Target ID | GM-T94695 |
Target Name | SMAD7 |
Gene ID | 4092, 17131, 698338, 81516, 101088277, 490570, 535916, 100033853 |
Gene Symbol and Synonyms | CRCS3,MADH7,MADH8,SMAD7 |
Uniprot Accession | O15105 |
Uniprot Entry Name | SMAD7_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target, Cytokine Target |
Disease | Cancer |
Gene Ensembl | ENSG00000101665 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.