Human IL25/IL-17E/IL-25 ORF/cDNA clone-Adenovirus plasmid (BC069565)

Cat. No.: pGMAP000371
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL25/IL-17E/IL-25 adenoviral expression plasmid for IL25 adenovirus packaging, IL25 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL25/IL-17E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000371
Gene Name IL25
Accession Number BC069565
Gene ID 64806
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 534 bp
Gene Alias IL-17E,IL-25
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGAGCGACCCAGATTAGGTGAGGACAGTTCTCTCATTAGCCTTTTCCTACAGGTGGTTGCATTCTTGGCAATGGTCATGGGAACCCACACCTACAGCCACTGGCCCAGCTGCTGCCCCAGCAAAGGGCAGGACACCTCTGAGGAGCTGCTGAGGTGGAGCACTGTGCCTGTGCCTCCCCTAGAGCCTGCTAGGCCCAACCGCCACCCAGAGTCCTGTAGGGCCAGTGAAGATGGACCCCTCAACAGCAGGGCCATCTCCCCCTGGAGATATGAGTTGGACAGAGACTTGAACCGGCTCCCCCAGGACCTGTACCACGCCCGTTGCCTGTGCCCGCACTGCGTCAGCCTACAGACAGGCTCCCACATGGACCCCCGGGGCAACTCGGAGCTGCTCTACCACAACCAGACTGTCTTCTACAGGCGGCCATGCCATGGCGAGAAGGGCACCCACAAGGGCTACTGCCTGGAGCGCAGGCTGTACCGTGTTTCCTTAGCTTGTGTGTGTGTGCGGCCCCGTGTGATGGGCTAG
ORF Protein Sequence MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T62241-Ab Anti-IL25/ IL17E functional antibody
    Target Antigen GM-Tg-g-T62241-Ag IL25 protein
    Cytokine cks-Tg-g-GM-T62241 Interleukin 25 (IL25) protein & antibody
    ORF Viral Vector pGMAP000371 Human IL25 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-032 Human IL25 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-115 Human IL25 Adenovirus plasmid
    ORF Viral Vector vGMAP000371 Human IL25 Adenovirus particle
    ORF Viral Vector vGMLP-IL-032 Human IL25 Lentivirus particle
    ORF Viral Vector vGMAP-IL-115 Human IL25 Adenovirus particle


    Target information

    Target ID GM-T62241
    Target Name IL25
    Gene ID 64806, 140806, 713943, 501996, 101095746, 480252, 526816, 111768801
    Gene Symbol and Synonyms IL-17e,IL-25,IL17E,IL25,RGD1561632
    Uniprot Accession Q9H293
    Uniprot Entry Name IL25_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000166090
    Target Classification Not Available

    The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.