Human IL17C/CX2/IL-17C ORF/cDNA clone-Adenovirus plasmid (NM_013278)
Cat. No.: pGMAP-IL-105
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL17C/CX2/IL-17C adenoviral expression plasmid for IL17C adenovirus packaging, IL17C adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL17C/CX2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP-IL-105 |
Gene Name | IL17C |
Accession Number | NM_013278 |
Gene ID | 27189 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 594 bp |
Gene Alias | CX2,IL-17C |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGACGCTCCTCCCCGGCCTCCTGTTTCTGACCTGGCTGCACACATGCCTGGCCCACCATGACCCCTCCCTCAGGGGGCACCCCCACAGTCACGGTACCCCACACTGCTACTCGGCTGAGGAACTGCCCCTCGGCCAGGCCCCCCCACACCTGCTGGCTCGAGGTGCCAAGTGGGGGCAGGCTTTGCCTGTAGCCCTGGTGTCCAGCCTGGAGGCAGCAAGCCACAGGGGGAGGCACGAGAGGCCCTCAGCTACGACCCAGTGCCCGGTGCTGCGGCCGGAGGAGGTGTTGGAGGCAGACACCCACCAGCGCTCCATCTCACCCTGGAGATACCGTGTGGACACGGATGAGGACCGCTATCCACAGAAGCTGGCCTTCGCCGAGTGCCTGTGCAGAGGCTGTATCGATGCACGGACGGGCCGCGAGACAGCTGCGCTCAACTCCGTGCGGCTGCTCCAGAGCCTGCTGGTGCTGCGCCGCCGGCCCTGCTCCCGCGACGGCTCGGGGCTCCCCACACCTGGGGCCTTTGCCTTCCACACCGAGTTCATCCACGTCCCCGTCGGCTGCACCTGCGTGCTGCCCCGTTCAGTGTGA |
ORF Protein Sequence | MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1022-Ab | Anti-IL17C/ CX2/ IL-17C functional antibody |
Target Antigen | GM-Tg-g-SE1022-Ag | IL17C protein |
Cytokine | cks-Tg-g-GM-SE1022 | interleukin 17C (IL17C) protein & antibody |
ORF Viral Vector | pGMLP004492 | Human IL17C Lentivirus plasmid |
ORF Viral Vector | pGMLP-IL-022 | Human IL17C Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-105 | Human IL17C Adenovirus plasmid |
ORF Viral Vector | vGMLP004492 | Human IL17C Lentivirus particle |
ORF Viral Vector | vGMLP-IL-022 | Human IL17C Lentivirus particle |
ORF Viral Vector | vGMAP-IL-105 | Human IL17C Adenovirus particle |
Target information
Target ID | GM-SE1022 |
Target Name | IL17C |
Gene ID | 27189, 234836, 710618, 691516, 101097443, 608988, 100050766 |
Gene Symbol and Synonyms | CX2,IL-17C,IL17C |
Uniprot Accession | Q9P0M4 |
Uniprot Entry Name | IL17C_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Cancer |
Gene Ensembl | ENSG00000124391 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.