Human NEU1/NANH/NEU ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000434.3)
Cat. No.: pGMAAV001253
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NEU1/NANH/NEU Adeno-associated virus expression plasmid (ITR-vector) for NEU1 AAV packaging, NEU1 AAV production.The purified Human NEU1/NANH/NEU AAV particle serves as an invaluable asset for in-depth in vivo NEU1 studies, mechanism of action (MOA) research, and the evolution of NEU1-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
NEU1/NANH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV001253 |
Gene Name | NEU1 |
Accession Number | NM_000434.3 |
Gene ID | 4758 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 1248 bp |
Gene Alias | NANH,NEU,SIAL1 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | GFAP |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTGGGGAGCGACCCAGCACGGCGCTCCCGGACAGACGCTGGGGGCCGCGGATTCTGGGCTTCTGGGGAGGCTGTAGGGTTTGGGTGTTTGCCGCGATCTTCCTGCTGCTGTCTCTGGCAGCCTCCTGGTCCAAGGCTGAGAACGACTTCGGTCTGGTGCAGCCGCTGGTGACCATGGAGCAACTGCTGTGGGTGAGCGGGAGACAGATCGGCTCAGTGGACACCTTCCGCATCCCGCTCATCACAGCCACTCCGCGGGGCACTCTTCTCGCCTTTGCTGAGGCGAGGAAAATGTCCTCATCCGATGAGGGGGCCAAGTTCATCGCCCTGCGGAGGTCCATGGACCAGGGCAGCACATGGTCTCCTACAGCGTTCATTGTCAATGATGGGGATGTCCCCGATGGGCTGAACCTTGGGGCAGTAGTGAGCGATGTTGAGACAGGAGTAGTATTTCTTTTCTACTCCCTTTGTGCTCACAAGGCCGGCTGCCAGGTGGCCTCTACCATGTTGGTATGGAGCAAGGATGATGGTGTTTCCTGGAGCACACCCCGGAATCTCTCCCTGGATATTGGCACTGAAGTGTTTGCCCCTGGACCGGGCTCTGGTATTCAGAAACAGCGGGAGCCACGGAAGGGCCGCCTCATCGTGTGTGGCCATGGGACGCTGGAGCGGGACGGAGTCTTCTGTCTCCTCAGCGATGATCATGGTGCCTCCTGGCGCTACGGAAGTGGGGTCAGCGGCATCCCCTACGGTCAGCCCAAGCAGGAAAATGATTTCAATCCTGATGAATGCCAGCCCTATGAGCTCCCAGATGGCTCAGTCGTCATCAATGCCCGAAACCAGAACAACTACCACTGCCACTGCCGAATTGTCCTCCGCAGCTATGATGCCTGTGATACACTAAGGCCCCGTGATGTGACCTTCGACCCTGAGCTCGTGGACCCTGTGGTAGCTGCAGGAGCTGTAGTCACCAGCTCCGGCATTGTCTTCTTCTCCAACCCAGCACATCCAGAGTTCCGAGTGAACCTGACCCTGCGATGGAGCTTCAGCAATGGTACCTCATGGCGGAAAGAGACAGTCCAGCTATGGCCAGGCCCCAGTGGCTATTCATCCCTGGCAACCCTGGAGGGCAGCATGGATGGAGAGGAGCAGGCCCCCCAGCTCTACGTCCTGTATGAGAAAGGCCGGAACCACTACACAGAGAGCATCTCCGTGGCCAAAATCAGTGTCTATGGGACACTCTGA |
ORF Protein Sequence | MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0874-Ab | Anti-NEUR1/ NEU1/ NANH monoclonal antibody |
Target Antigen | GM-Tg-g-MP0874-Ag | NEU1 VLP (virus-like particle) |
ORF Viral Vector | pGMLV002700 | Human NEU1 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000260 | Human NEU1 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAAV000796 | Human NEU1 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAAV001253 | Human NEU1 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAP000094 | Human NEU1 Adenovirus plasmid |
ORF Viral Vector | pGMPC001869 | Human NEU1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV002700 | Human NEU1 Lentivirus particle |
ORF Viral Vector | vGMAAV000260 | Human NEU1 Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAAV000796 | Human NEU1 Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAAV001253 | Human NEU1 Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAP000094 | Human NEU1 Adenovirus particle |
Target information
Target ID | GM-MP0874 |
Target Name | NEU1 |
Gene ID | 4758, 18010, 716740, 24591, 101091282, 481717, 505554, 100059083 |
Gene Symbol and Synonyms | Aglp,Apl,Bat-7,Bat7,G9,Map-2,NANH,NEU,Neu-1,NEU1,SIAL1 |
Uniprot Accession | Q99519 |
Uniprot Entry Name | NEUR1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000204386 |
Target Classification | Not Available |
The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.