Human BDNF/ANON2/BULN2 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_170735.5)

Cat. No.: pGMAAV000575
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BDNF/ANON2/BULN2 Adeno-associated virus expression plasmid (ITR-vector) for BDNF AAV packaging, BDNF AAV production.The purified Human BDNF/ANON2/BULN2 AAV particle serves as an invaluable asset for in-depth in vivo BDNF studies, mechanism of action (MOA) research, and the evolution of BDNF-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BDNF/ANON2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000575
Gene Name BDNF
Accession Number NM_170735.5
Gene ID 627
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 744 bp
Gene Alias ANON2,BULN2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTTGGTTGCATGAAGGCTGCCCCCATGAAAGAAGCAAACATCCGAGGACAAGGTGGCTTGGCCTACCCAGGTGTGCGGACCCATGGGACTCTGGAGAGCGTGAATGGGCCCAAGGCAGGTTCAAGAGGCTTGACATCATTGGCTGACACTTTCGAACACGTGATAGAAGAGCTGTTGGATGAGGACCAGAAAGTTCGGCCCAATGAAGAAAACAATAAGGACGCAGACTTGTACACGTCCAGGGTGATGCTCAGTAGTCAAGTGCCTTTGGAGCCTCCTCTTCTCTTTCTGCTGGAGGAATACAAAAATTACCTAGATGCTGCAAACATGTCCATGAGGGTCCGGCGCCACTCTGACCCTGCCCGCCGAGGGGAGCTGAGCGTGTGTGACAGTATTAGTGAGTGGGTAACGGCGGCAGACAAAAAGACTGCAGTGGACATGTCGGGCGGGACGGTCACAGTCCTTGAAAAGGTCCCTGTATCAAAAGGCCAACTGAAGCAATACTTCTACGAGACCAAGTGCAATCCCATGGGTTACACAAAAGAAGGCTGCAGGGGCATAGACAAAAGGCATTGGAACTCCCAGTGCCGAACTACCCAGTCGTACGTGCGGGCCCTTACCATGGATAGCAAAAAGAGAATTGGCTGGCGATTCATAAGGATAGACACTTCTTGTGTATGTACATTGACCATTAAAAGGGGAAGATAG
ORF Protein Sequence MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93122-Ab Anti-BDNF/ ANON2/ BULN2 functional antibody
    Target Antigen GM-Tg-g-T93122-Ag BDNF protein
    ORF Viral Vector pGMLP004025 Human BDNF Lentivirus plasmid
    ORF Viral Vector pGMAD000577 Human BDNF Adenovirus plasmid
    ORF Viral Vector pGMAAV000575 Human BDNF Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000316 Human BDNF Adenovirus plasmid
    ORF Viral Vector pGMPC000136 Human BNDF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000188 Human BDNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004727 Human BDNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004025 Human BDNF Lentivirus particle
    ORF Viral Vector vGMAD000577 Human BDNF Adenovirus particle
    ORF Viral Vector vGMAAV000575 Human BDNF Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000316 Human BDNF Adenovirus particle


    Target information

    Target ID GM-T93122
    Target Name BDNF
    Gene ID 627, 12064, 701245, 24225, 493690, 403461, 617701, 100009689
    Gene Symbol and Synonyms ANON2,BDNF,BULN2
    Uniprot Accession P23560
    Uniprot Entry Name BDNF_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Prostate Cancer, ovarian cancer, Overactive bladder, Autism, mental retardation, Allergic reactions, Asthma, Parkinson's Disease
    Gene Ensembl ENSG00000176697
    Target Classification Not Available

    This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.