Human FGF23/ADHR/FGFN ORF/cDNA clone-Lentivirus particle (NM_020638.3)
Cat. No.: vGMLV002454
Pre-made Human FGF23/ADHR/FGFN Lentiviral expression plasmid for FGF23 lentivirus packaging, FGF23 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FGF23/ADHR products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002454 | Human FGF23 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002454 |
Gene Name | FGF23 |
Accession Number | NM_020638.3 |
Gene ID | 8074 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 756 bp |
Gene Alias | ADHR,FGFN,HFTC2,HPDR2,HYPF,PHPTC |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTTGGGGGCCCGCCTCAGGCTCTGGGTCTGTGCCTTGTGCAGCGTCTGCAGCATGAGCGTCCTCAGAGCCTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATCCACCTGTACACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCATGTGGATGGCGCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCTGGCTTTGTGGTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGCAACATTTTTGGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTGGAAAACGGGTACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGGGCGAAGAGAGCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGGAGGAACGAGATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCGGAGCGCCGAGGACGACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACCCCGGCCCCGGCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCCAGTGACCCATTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGCCCGGAAGGCTGCCGCCCCTTCGCCAAGTTCATCTAG |
ORF Protein Sequence | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-086 | Pre-Made Burosumab biosimilar, Whole mAb, Anti-FGF23 Antibody: Anti-ADHR/FGFN/HFTC2/HPDR2/HYPF/PHPTC therapeutic antibody |
Target Antibody | GM-Tg-g-T14853-Ab | Anti-FGF23/ ADHR/ FGFN functional antibody |
Target Antigen | GM-Tg-g-T14853-Ag | FGF23 protein |
Cytokine | cks-Tg-g-GM-T14853 | fibroblast growth factor 23 (FGF23) protein & antibody |
ORF Viral Vector | pGMLV002454 | Human FGF23 Lentivirus plasmid |
ORF Viral Vector | pGMAD000303 | Human FGF23 Adenovirus plasmid |
ORF Viral Vector | pGMAD001005 | Human FGF23 Adenovirus plasmid |
ORF Viral Vector | pGMPC001426 | Human FGF23 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV002454 | Human FGF23 Lentivirus particle |
ORF Viral Vector | vGMAD000303 | Human FGF23 Adenovirus particle |
ORF Viral Vector | vGMAD001005 | Human FGF23 Adenovirus particle |
Target information
Target ID | GM-T14853 |
Target Name | FGF23 |
Gene ID | 8074, 64654, 710643, 170583, 101100063, 611773, 530239, 100058460 |
Gene Symbol and Synonyms | ADHR,FGF23,Fgf8b,FGFN,HFTC2,HPDR2,HYPF,PHPTC |
Uniprot Accession | Q9GZV9 |
Uniprot Entry Name | FGF23_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index, Cytokine Target |
Disease | Hypertension, Localized osteoporosis [Lequesne] |
Gene Ensembl | ENSG00000118972 |
Target Classification | Not Available |
This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.