Human TMSB4X/FX/PTMB4 ORF/cDNA clone-Lentivirus particle (NM_021109.3)

Cat. No.: vGMLV001370

Pre-made Human TMSB4X/FX/PTMB4 Lentiviral expression plasmid for TMSB4X lentivirus packaging, TMSB4X lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMSB4X/FX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001370 Human TMSB4X Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001370
Gene Name TMSB4X
Accession Number NM_021109.3
Gene ID 7114
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 135 bp
Gene Alias FX,PTMB4,TB4X,TMSB4
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGACAAACCCGATATGGCTGAGATCGAGAAATTCGATAAGTCGAAACTGAAGAAGACAGAGACGCAAGAGAAAAATCCACTGCCTTCCAAAGAAACGATTGAACAGGAGAAGCAAGCAGGCGAATCGTAA
ORF Protein Sequence MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85005-Ab Anti-TMSB4X monoclonal antibody
    Target Antigen GM-Tg-g-T85005-Ag TMSB4X protein
    ORF Viral Vector pGMLP003137 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV000075 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV001370 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV002575 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMPC001441 Human TMSB4X Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003137 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV000075 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV001370 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV002575 Human TMSB4X Lentivirus particle


    Target information

    Target ID GM-T85005
    Target Name TMSB4X
    Gene ID 7114, 19241, 710959, 81814, 101088815, 100684977, 282386, 100034015
    Gene Symbol and Synonyms FX,PTMB4,Tb4,TB4X,Tbeta4,THYB4,TMSB4,TMSB4X
    Uniprot Accession P62328
    Uniprot Entry Name TYB4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000205542
    Target Classification Not Available

    This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.