Human CTF1/CT-1/CT1 ORF/cDNA clone-Lentivirus particle (NM_001330.3)
Cat. No.: vGMLV000332
Pre-made Human CTF1/CT-1/CT1 Lentiviral expression plasmid for CTF1 lentivirus packaging, CTF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CTF1/CT-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV000332 | Human CTF1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV000332 |
Gene Name | CTF1 |
Accession Number | NM_001330.3 |
Gene ID | 1489 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 606 bp |
Gene Alias | CT-1,CT1 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGCCGGAGGGAGGGAAGTCTGGAAGACCCCCAGACTGATTCCTCAGTCTCACTTCTTCCCCACTTGGAGGCCAAGATCCGTCAGACACACAGCCTTGCGCACCTCCTCACCAAATACGCTGAGCAGCTGCTCCAGGAATATGTGCAGCTCCAGGGAGACCCCTTCGGGCTGCCCAGCTTCTCGCCGCCGCGGCTGCCGGTGGCCGGCCTGAGCGCCCCGGCTCCGAGCCACGCGGGGCTGCCAGTGCACGAGCGGCTGCGGCTGGACGCGGCGGCGCTGGCCGCGCTGCCCCCGCTGCTGGACGCAGTGTGTCGCCGCCAGGCCGAGCTGAACCCGCGCGCGCCGCGCCTGCTGCGCCGCCTGGAGGACGCGGCGCGCCAGGCCCGGGCCCTGGGCGCCGCCGTGGAGGCCTTGCTGGCCGCGCTGGGCGCCGCCAACCGCGGGCCCCGGGCCGAGCCCCCCGCCGCCACCGCCTCAGCCGCCTCCGCCACCGGGGTCTTCCCCGCCAAGGTGCTGGGGCTCCGCGTTTGCGGCCTCTACCGCGAGTGGCTGAGCCGCACCGAGGGCGACCTGGGCCAGCTGCTGCCCGGGGGCTCGGCCTGA |
ORF Protein Sequence | MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T94977-Ab | Anti-CTF1/ CT-1/ CT1 functional antibody |
Target Antigen | GM-Tg-g-T94977-Ag | CTF1 protein |
Cytokine | cks-Tg-g-GM-T94977 | cardiotrophin 1 (CTF1) protein & antibody |
ORF Viral Vector | pGMLP004846 | Human CTF1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000332 | Human CTF1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004846 | Human CTF1 Lentivirus particle |
ORF Viral Vector | vGMLV000332 | Human CTF1 Lentivirus particle |
Target information
Target ID | GM-T94977 |
Target Name | CTF1 |
Gene ID | 1489, 13019, 713850, 29201, 403821, 514803 |
Gene Symbol and Synonyms | CT-1,CT1,CTF1 |
Uniprot Accession | Q16619 |
Uniprot Entry Name | CTF1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000150281 |
Target Classification | Not Available |
The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.