Human CCL20/CKb4/Exodus ORF/cDNA clone-Lentivirus particle (NM_004591.2)

Cat. No.: vGMLV000235

Pre-made Human CCL20/CKb4/Exodus Lentiviral expression plasmid for CCL20 lentivirus packaging, CCL20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CCL20/CKb4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000235 Human CCL20 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000235
Gene Name CCL20
Accession Number NM_004591.2
Gene ID 6364
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 291 bp
Gene Alias CKb4,Exodus,LARC,MIP-3-alpha,MIP-3a,MIP3A,SCYA20,ST38
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAATCAGAAGCAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGGCTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTGTCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGAACATGTAA
ORF Protein Sequence MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T04894-Ab Anti-CCL20/ CKb4/ Exodus functional antibody
    Target Antigen GM-Tg-g-T04894-Ag CCL20 protein
    Cytokine cks-Tg-g-GM-T04894 chemokine (C-C motif) ligand 20 (CCL20) protein & antibody
    ORF Viral Vector pGMLV000235 Human CCL20 Lentivirus plasmid
    ORF Viral Vector pGMAAV000788 Human CCL20 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLV000235 Human CCL20 Lentivirus particle
    ORF Viral Vector vGMAAV000788 Human CCL20 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T04894
    Target Name CCL20
    Gene ID 6364, 20297, 574182, 29538, 101089032, 448790, 281666, 100629808
    Gene Symbol and Synonyms CCL20,CKb4,Exodus,exodus-1,LARC,MIP-3-alpha,MIP-3a,MIP-3[a],MIP3A,SCYA20,ST38
    Uniprot Accession P78556
    Uniprot Entry Name CCL20_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000115009
    Target Classification Checkpoint-Immuno Oncology

    This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene displays chemotactic activity for lymphocytes and can repress proliferation of myeloid progenitors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.