Human SOST/CDD/DAND6 ORF/cDNA clone-Lentivirus particle (NM_025237)
Cat. No.: vGMLP005026
Pre-made Human SOST/CDD/DAND6 Lentiviral expression plasmid for SOST lentivirus packaging, SOST lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SOST/CDD products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005026 | Human SOST Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005026 |
Gene Name | SOST |
Accession Number | NM_025237 |
Gene ID | 50964 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 642 bp |
Gene Alias | CDD,DAND6,SOST1,VBCH |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGCTCCCACTGGCCCTGTGTCTCGTCTGCCTGCTGGTACACACAGCCTTCCGTGTAGTGGAGGGCCAGGGGTGGCAGGCGTTCAAGAATGATGCCACGGAAATCATCCCCGAGCTCGGAGAGTACCCCGAGCCTCCACCGGAGCTGGAGAACAACAAGACCATGAACCGGGCGGAGAACGGAGGGCGGCCTCCCCACCACCCCTTTGAGACCAAAGACGTGTCCGAGTACAGCTGCCGCGAGCTGCACTTCACCCGCTACGTGACCGATGGGCCGTGCCGCAGCGCCAAGCCGGTCACCGAGCTGGTGTGCTCCGGCCAGTGCGGCCCGGCGCGCCTGCTGCCCAACGCCATCGGCCGCGGCAAGTGGTGGCGACCTAGTGGGCCCGACTTCCGCTGCATCCCCGACCGCTACCGCGCGCAGCGCGTGCAGCTGCTGTGTCCCGGTGGTGAGGCGCCGCGCGCGCGCAAGGTGCGCCTGGTGGCCTCGTGCAAGTGCAAGCGCCTCACCCGCTTCCACAACCAGTCGGAGCTCAAGGACTTCGGGACCGAGGCCGCTCGGCCGCAGAAGGGCCGGAAGCCGCGGCCCCGCGCCCGGAGCGCCAAAGCCAACCAGGCCGAGCTGGAGAACGCCTACTAG |
ORF Protein Sequence | MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-493 | Pre-Made Romosozumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody |
Biosimilar | GMP-Bios-ab-076 | Pre-Made Blosozumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody |
Biosimilar | GMP-Bios-ab-517 | Pre-Made Setrusumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody |
Target Antibody | GM-Tg-g-T60724-Ab | Anti-SOST/ CDD/ DAND61 functional antibody |
Target Antigen | GM-Tg-g-T60724-Ag | SOST protein |
ORF Viral Vector | pGMLP005026 | Human SOST Lentivirus plasmid |
ORF Viral Vector | pGMLV000058 | Human SOST Lentivirus plasmid |
ORF Viral Vector | pGMLV000548 | Human SOST Lentivirus plasmid |
ORF Viral Vector | pGMPC000724 | Human SOST Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP005026 | Human SOST Lentivirus particle |
ORF Viral Vector | vGMLV000058 | Human SOST Lentivirus particle |
ORF Viral Vector | vGMLV000548 | Human SOST Lentivirus particle |
Target information
Target ID | GM-T60724 |
Target Name | SOST |
Gene ID | 50964, 74499, 713617, 80722, 101083725, 490948, 282880, 100065060 |
Gene Symbol and Synonyms | 5430411E23Rik,CDD,DAND6,SOST,SOST1,VBCH |
Uniprot Accession | Q9BQB4 |
Uniprot Entry Name | SOST_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000167941 |
Target Classification | Not Available |
Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.