Human FGF3/HBGF-3/INT2 ORF/cDNA clone-Lentivirus particle (NM_005247)
Cat. No.: vGMLP004989
Pre-made Human FGF3/HBGF-3/INT2 Lentiviral expression plasmid for FGF3 lentivirus packaging, FGF3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FGF3/HBGF-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004989 | Human FGF3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004989 |
Gene Name | FGF3 |
Accession Number | NM_005247 |
Gene ID | 2248 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 720 bp |
Gene Alias | HBGF-3,INT2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCCTAATCTGGCTGCTACTGCTCAGCCTGCTGGAGCCCGGCTGGCCCGCAGCGGGCCCTGGGGCGCGGTTGCGGCGCGATGCGGGCGGCCGTGGCGGCGTCTACGAGCACCTTGGCGGGGCGCCCCGGCGCCGCAAGCTCTACTGCGCCACGAAGTACCACCTCCAGCTGCACCCGAGCGGCCGCGTCAACGGCAGCCTGGAGAACAGCGCCTACAGTATTTTGGAGATAACGGCAGTGGAGGTGGGCATTGTGGCCATCAGGGGTCTCTTCTCCGGGCGGTACCTGGCCATGAACAAGAGGGGACGACTCTATGCTTCGGAGCACTACAGCGCCGAGTGCGAGTTTGTGGAGCGGATCCACGAGCTGGGCTATAATACGTATGCCTCCCGGCTGTACCGGACGGTGTCTAGTACGCCTGGGGCCCGCCGGCAGCCCAGCGCCGAGAGACTGTGGTACGTGTCTGTGAACGGCAAGGGCCGGCCCCGCAGGGGCTTCAAGACCCGCCGCACACAGAAGTCCTCCCTGTTCCTGCCCCGCGTGCTGGACCACAGGGACCACGAGATGGTGCGGCAGCTACAGAGTGGGCTGCCCAGACCCCCTGGTAAGGGGGTCCAGCCCCGACGGCGGCGGCAGAAGCAGAGCCCGGATAACCTGGAGCCCTCTCACGTTCAGGCTTCGAGACTGGGCTCCCAGCTGGAGGCCAGTGCGCACTAG |
ORF Protein Sequence | MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0921-Ab | Anti-FGF3/ HBGF-3/ INT2 functional antibody |
Target Antigen | GM-Tg-g-SE0921-Ag | FGF3 protein |
Cytokine | cks-Tg-g-GM-SE0921 | fibroblast growth factor 3 (FGF3) protein & antibody |
ORF Viral Vector | pGMLP004989 | Human FGF3 Lentivirus plasmid |
ORF Viral Vector | vGMLP004989 | Human FGF3 Lentivirus particle |
Target information
Target ID | GM-SE0921 |
Target Name | FGF3 |
Gene ID | 2248, 14174, 708918, 170633, 111556666, 611707, 618481, 100146649 |
Gene Symbol and Synonyms | Fgf-3,FGF3,Fgf5c,HBGF-3,Int-2,Int-P,INT2 |
Uniprot Accession | P11487 |
Uniprot Entry Name | FGF3_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Cancer |
Gene Ensembl | ENSG00000186895 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.