Human RGS19/GAIP/RGSGAIP ORF/cDNA clone-Lentivirus particle (NM_005873)

Cat. No.: vGMLP004893

Pre-made Human RGS19/GAIP/RGSGAIP Lentiviral expression plasmid for RGS19 lentivirus packaging, RGS19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RGS19/GAIP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004893 Human RGS19 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004893
Gene Name RGS19
Accession Number NM_005873
Gene ID 10287
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 654 bp
Gene Alias GAIP,RGSGAIP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCACCCCGCATGAGGCTGAGAAGCAGATCACAGGGCCAGAGGAGGCGGACCGGCCCCCTTCAATGTCCAGTCATGATACAGCCTCTCCAGCGGCCCCCAGCCGCAACCCCTGCTGCCTGTGCTGGTGCTGCTGCTGTAGCTGCTCCTGGAACCAAGAGCGGCGGCGCGCGTGGCAGGCCTCCCGGGAGAGCAAGCTGCAGCCCCTCCCCAGCTGTGAAGTATGTGCCACGCCAAGTCCTGAGGAGGTGCAGAGCTGGGCGCAGTCTTTTGACAAGCTGATGCACAGCCCAGCGGGACGCAGCGTGTTCCGGGCGTTCCTGCGGACAGAGTACAGCGAGGAGAACATGCTCTTCTGGTTGGCCTGCGAGGAGCTGAAGGCCGAGGCCAACCAGCATGTGGTAGACGAGAAGGCGAGGCTCATCTACGAGGACTACGTATCCATCCTGTCCCCCAAGGAGGTGAGCCTGGACTCCCGTGTGCGGGAGGGCATCAACAAGAAGATGCAGGAGCCGTCCGCACACACGTTCGACGACGCGCAGCTGCAGATCTACACGCTCATGCACCGGGACTCCTACCCCCGCTTCCTCAGCTCTCCCACCTACCGTGCCCTGCTGCTGCAGGGGCCATCACAGTCCTCCTCCGAGGCCTAG
ORF Protein Sequence MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2297-Ab Anti-RGS19/ GAIP/ RGSGAIP monoclonal antibody
    Target Antigen GM-Tg-g-MP2297-Ag RGS19 VLP (virus-like particle)
    ORF Viral Vector pGMLP004893 Human RGS19 Lentivirus plasmid
    ORF Viral Vector pGMLV001210 Human RGS19 Lentivirus plasmid
    ORF Viral Vector vGMLP004893 Human RGS19 Lentivirus particle
    ORF Viral Vector vGMLV001210 Human RGS19 Lentivirus particle


    Target information

    Target ID GM-MP2297
    Target Name RGS19
    Gene ID 10287, 56470, 719265, 59293, 101091098, 491407, 539036, 100051702
    Gene Symbol and Synonyms 2610042F04Rik,Camki,GAIP,RGS19,RGSGAIP
    Uniprot Accession P49795
    Uniprot Entry Name RGS19_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000171700
    Target Classification Not Available

    G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.