Human ACYP2/ACYM/ACYP ORF/cDNA clone-Lentivirus particle (NM_001320586)

Cat. No.: vGMLP004867

Pre-made Human ACYP2/ACYM/ACYP Lentiviral expression plasmid for ACYP2 lentivirus packaging, ACYP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ACYP2/ACYM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004867 Human ACYP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004867
Gene Name ACYP2
Accession Number NM_001320586
Gene ID 98
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 519 bp
Gene Alias ACYM,ACYP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGCTCACACAAAGCCTGTTTGGTGGTCTCTTCCCACGGACGCGCGAGACAATGAGGAGATACAAGGTCTCGCTGTTCTACCTAGGCTGTTCTAGAACTCCTAATGTCAAGCTATCCTCCTGCCTCGGCCTCCCATGCTGTTGGGATTACAGCTATAAATTCATACAATTATCAGAGTTTGGTTTTGGTCAAGTCATAATTGTGAGTGAAGAACCATGGAAGGAGAACATTTCTTGCTCATCAACTACTTTCATAAAATCAACAATTTGCTTAAGTGTTTGCTTCAGAATGTATACAGAAGATGAAGCTAGGAAAATAGGAGTGGTTGGCTGGGTGAAGAATACCAGCAAAGGCACCGTGACAGGCCAAGTGCAGGGGCCAGAAGACAAAGTCAATTCCATGAAGTCCTGGCTGAGCAAGGTTGGAAGCCCTAGTTCTCGCATTGACCGCACAAACTTTTCTAATGAAAAAACCATCTCTAAGCTTGAATACTCTAATTTTAGTATTAGATACTAA
ORF Protein Sequence MLLTQSLFGGLFPRTRETMRRYKVSLFYLGCSRTPNVKLSSCLGLPCCWDYSYKFIQLSEFGFGQVIIVSEEPWKENISCSSTTFIKSTICLSVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1595-Ab Anti-ACYP2/ ACYM/ ACYP functional antibody
    Target Antigen GM-Tg-g-SE1595-Ag ACYP2 protein
    ORF Viral Vector pGMLP004867 Human ACYP2 Lentivirus plasmid
    ORF Viral Vector vGMLP004867 Human ACYP2 Lentivirus particle


    Target information

    Target ID GM-SE1595
    Target Name ACYP2
    Gene ID 98, 75572, 716728, 364224, 101095570, 474595, 767889, 100630291
    Gene Symbol and Synonyms 2310004B09Rik,ACYM,ACYP,ACYP2
    Uniprot Accession P14621
    Uniprot Entry Name ACYP2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170634
    Target Classification Not Available

    Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.