Human CSF3/C17orf33/CSF3OS ORF/cDNA clone-Lentivirus particle (NM_000759)
                                                               Cat. No.: vGMLP004541
 
                                                               
                                                               
                                                                
                                                                
                                                                 
                                                                
                                                            
Pre-made Human CSF3/C17orf33/CSF3OS Lentiviral expression plasmid for CSF3 lentivirus packaging, CSF3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
                                                                            CSF3/C17orf33 products
                                                                            collection>>
(antibodies,
                                                                            antigen, VLP, mRNA, ORF viral vector, etc)
                                                                        
                                                                    
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity | 
|---|---|---|---|
| vGMLP004541 | Human CSF3 Lentivirus particle | Pilot Grade | 1.0E+8TU | 
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry | 
Product Description
| Catalog ID | vGMLP004541 | 
| Gene Name | CSF3 | 
| Accession Number | NM_000759 | 
| Gene ID | 1440 | 
| Species | Human | 
| Product Type | Lentivirus particle (overexpression) | 
| Insert Length | 624 bp | 
| Gene Alias | C17orf33,CSF3OS,GCSF | 
| Fluorescent Reporter | ZsGreen | 
| Mammalian Cell Selection | Puromyocin | 
| Fusion Tag | 3xflag (C-Terminal) | 
| Promoter | CMV | 
| Resistance | Amplicin | 
| ORF Nucleotide Sequence | ATGGCTGGACCTGCCACCCAGAGCCCCATGAAGCTGATGGCCCTGCAGCTGCTGCTGTGGCACAGTGCACTCTGGACAGTGCAGGAAGCCACCCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGGTGAGTGAGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCAGCTGCCCCAGCCAGGCCCTGCAGCTGGCAGGCTGCTTGAGCCAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGCAGGCCCTGGAAGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTGCAGCTGGACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCTGCAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTGCCTCCCATCTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCCCAGCCCTGA | 
| ORF Protein Sequence | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP | 
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name | 
|---|---|---|
| Target Antibody | GM-Tg-g-T19615-Ab | Anti-CSF3/ C17orf33OS/ GCSF functional antibody | 
| Target Antigen | GM-Tg-g-T19615-Ag | CSF3 protein | 
| ORF Viral Vector | pGMLP004541 | Human CSF3 Lentivirus plasmid | 
| ORF Viral Vector | vGMLP004541 | Human CSF3 Lentivirus particle | 
Target information
| Target ID | GM-T19615 | 
| Target Name | CSF3 | 
| Gene ID | 1440, 12985, 698961, 25610, 493700, 608246, 281096, 100033922 | 
| Gene Symbol and Synonyms | C17orf33,CSF3,CSF3OS,Csfg,G-CSF,GCSF,MGI-IG | 
| Uniprot Accession | P09919 | 
| Uniprot Entry Name | CSF3_HUMAN | 
| Protein Sub-location | Secreted Protein/Potential Cytokines | 
| Category | Therapeutics Target | 
| Disease | metastatic tumors | 
| Gene Ensembl | ENSG00000108342 | 
| Target Classification | Not Available | 
This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.
 
                
                 
             
         
         
                                                            


 MSDS
 MSDS
                                                                