Human C10orf99/AP-57/AP57 ORF/cDNA clone-Lentivirus particle (NM_207373)

Cat. No.: vGMLP004142

Pre-made Human C10orf99/AP-57/AP57 Lentiviral expression plasmid for C10orf99 lentivirus packaging, C10orf99 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to C10orf99/AP-57 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004142 Human C10orf99 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004142
Gene Name C10orf99
Accession Number NM_207373
Gene ID 387695
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 246 bp
Gene Alias AP-57,AP57,CSBF,GPR15L,UNQ1833
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTTCTAGTCCTTTCCAGCCTGCTCTGTATCCTGCTTCTCTGCTTCTCCATCTTCTCCACAGAAGGGAAGAGGCGTCCTGCCAAGGCCTGGTCAGGCAGGAGAACCAGGCTCTGCTGCCACCGAGTCCCTAGCCCCAACTCAACAAACCTGAAAGGACATCATGTGAGGCTCTGTAAACCATGCAAGCTTGAGCCAGAGCCCCGCCTTTGGGTGGTGCCTGGGGCACTCCCACAGGTGTAG
ORF Protein Sequence MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0049-Ab Anti-GP15L/ C10orf99/ AP-57 functional antibody
    Target Antigen GM-Tg-g-SE0049-Ag C10orf99 protein
    ORF Viral Vector pGMLP004142 Human C10orf99 Lentivirus plasmid
    ORF Viral Vector vGMLP004142 Human C10orf99 Lentivirus particle


    Target information

    Target ID GM-SE0049
    Target Name C10orf99
    Gene ID 387695, 70045, 107000136, 290595, 101083970, 111095709, 100336125, 102149943
    Gene Symbol and Synonyms 2610528A11Rik,AP-57,AP57,C10orf99,C1H10orf99,C28H10orf99,C4H10orf99,C9H10orf99,CD2H10orf99,CSBF,GPR15L,GPR15LG,UNQ1833
    Uniprot Accession Q6UWK7
    Uniprot Entry Name GP15L_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000188373
    Target Classification Not Available

    Enables chemokine activity. Involved in several processes, including defense response to other organism; lymphocyte chemotaxis; and negative regulation of cell cycle G1/S phase transition. Located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.