Human VAMP1/VAMP-1 ORF/cDNA clone-Lentivirus particle (BC023286)

Cat. No.: vGMLP003976

Pre-made Human VAMP1/VAMP-1 Lentiviral expression plasmid for VAMP1 lentivirus packaging, VAMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to VAMP1/VAMP-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003976 Human VAMP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003976
Gene Name VAMP1
Accession Number BC023286
Gene ID 6843
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 354 bp
Gene Alias VAMP-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGCTCCAGCTCAGCCACCTGCTGAAGGGACAGAAGGGACTGCCCCAGGTGGGGGTCCCCCTGGCCCTCCTCCTAACATGACCAGTAACAGACGACTACAGCAAACCCAGGCACAAGTGGAGGAGGTGGTGGACATCATACGTGTGAACGTGGACAAGGTCCTGGAGAGGGACCAGAAGCTGTCAGAGCTGGATGACCGAGCTGATGCCTTGCAGGCAGGAGCATCACAATTTGAGAGCAGTGCTGCAAAGCTAAAGAGGAAGTATTGGTGGAAAAACTGCAAGATGATGATCATGCTGGGAGCCATCTGTGCCATCATCGTGGTAGTTATTGTAAGTAAGTATCGCTGA
ORF Protein Sequence MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVSKYR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA034-Ab Anti-VAMP1/ SPAX1/ SYB1 monoclonal antibody
    Target Antigen GM-Tg-g-TA034-Ag VAMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003389 Human VAMP1 Lentivirus plasmid
    ORF Viral Vector pGMLP003976 Human VAMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP003389 Human VAMP1 Lentivirus particle
    ORF Viral Vector vGMLP003976 Human VAMP1 Lentivirus particle


    Target information

    Target ID GM-TA034
    Target Name VAMP1
    Gene ID 6843, 22317, 722049, 25624, 101092122, 486726, 513621, 100059722
    Gene Symbol and Synonyms CMS25,lew,SAX1,SPAX1,Syb-1,SYB1,VAMP-1,VAMP1
    Uniprot Accession P23763
    Uniprot Entry Name VAMP1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000139190
    Target Classification Not Available

    Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.