Human VAMP1/VAMP-1 ORF/cDNA clone-Lentivirus particle (BC023286)
Cat. No.: vGMLP003976
Pre-made Human VAMP1/VAMP-1 Lentiviral expression plasmid for VAMP1 lentivirus packaging, VAMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
VAMP1/VAMP-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003976 | Human VAMP1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003976 |
Gene Name | VAMP1 |
Accession Number | BC023286 |
Gene ID | 6843 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 354 bp |
Gene Alias | VAMP-1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCTGCTCCAGCTCAGCCACCTGCTGAAGGGACAGAAGGGACTGCCCCAGGTGGGGGTCCCCCTGGCCCTCCTCCTAACATGACCAGTAACAGACGACTACAGCAAACCCAGGCACAAGTGGAGGAGGTGGTGGACATCATACGTGTGAACGTGGACAAGGTCCTGGAGAGGGACCAGAAGCTGTCAGAGCTGGATGACCGAGCTGATGCCTTGCAGGCAGGAGCATCACAATTTGAGAGCAGTGCTGCAAAGCTAAAGAGGAAGTATTGGTGGAAAAACTGCAAGATGATGATCATGCTGGGAGCCATCTGTGCCATCATCGTGGTAGTTATTGTAAGTAAGTATCGCTGA |
ORF Protein Sequence | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVSKYR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA034-Ab | Anti-VAMP1/ SPAX1/ SYB1 monoclonal antibody |
Target Antigen | GM-Tg-g-TA034-Ag | VAMP1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003389 | Human VAMP1 Lentivirus plasmid |
ORF Viral Vector | pGMLP003976 | Human VAMP1 Lentivirus plasmid |
ORF Viral Vector | vGMLP003389 | Human VAMP1 Lentivirus particle |
ORF Viral Vector | vGMLP003976 | Human VAMP1 Lentivirus particle |
Target information
Target ID | GM-TA034 |
Target Name | VAMP1 |
Gene ID | 6843, 22317, 722049, 25624, 101092122, 486726, 513621, 100059722 |
Gene Symbol and Synonyms | CMS25,lew,SAX1,SPAX1,Syb-1,SYB1,VAMP-1,VAMP1 |
Uniprot Accession | P23763 |
Uniprot Entry Name | VAMP1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000139190 |
Target Classification | Not Available |
Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.