Human S100A14/BCMP84/S100A15 ORF/cDNA clone-Lentivirus particle (NM_020672)

Cat. No.: vGMLP003841

Pre-made Human S100A14/BCMP84/S100A15 Lentiviral expression plasmid for S100A14 lentivirus packaging, S100A14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to S100A14/BCMP84 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003841 Human S100A14 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003841
Gene Name S100A14
Accession Number NM_020672
Gene ID 57402
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 315 bp
Gene Alias BCMP84,S100A15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGACAGTGTCGGTCAGCCAACGCAGAGGATGCTCAGGAATTCAGTGATGTGGAGAGGGCCATTGAGACCCTCATCAAGAACTTTCACCAGTACTCCGTGGAGGGTGGGAAGGAGACGCTGACCCCTTCTGAGCTACGGGACCTGGTCACCCAGCAGCTGCCCCATCTCATGCCGAGCAACTGTGGCCTGGAAGAGAAAATTGCCAACCTGGGCAGCTGCAATGACTCTAAACTGGAGTTCAGGAGTTTCTGGGAGCTGATTGGAGAAGCGGCCAAGAGTGTGAAGCTGGAGAGGCCTGTCCGGGGGCACTGA
ORF Protein Sequence MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2723-Ab Anti-S100A14 monoclonal antibody
    Target Antigen GM-Tg-g-IP2723-Ag S100A14 protein
    ORF Viral Vector pGMLP003841 Human S100A14 Lentivirus plasmid
    ORF Viral Vector vGMLP003841 Human S100A14 Lentivirus particle


    Target information

    Target ID GM-IP2723
    Target Name S100A14
    Gene ID 57402, 66166, 718338, 685385, 101082372, 612322, 618250, 100147656
    Gene Symbol and Synonyms 1110013O05Rik,BCMP84,S100A14,S100A15,S114
    Uniprot Accession Q9HCY8
    Uniprot Entry Name S10AE_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000189334
    Target Classification Not Available

    This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.