Human GUCA2A/GCAP-I/GUCA2 ORF/cDNA clone-Lentivirus particle (NM_033553)

Cat. No.: vGMLP003388

Pre-made Human GUCA2A/GCAP-I/GUCA2 Lentiviral expression plasmid for GUCA2A lentivirus packaging, GUCA2A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GUCA2A/GCAP-I products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003388 Human GUCA2A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003388
Gene Name GUCA2A
Accession Number NM_033553
Gene ID 2980
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 348 bp
Gene Alias GCAP-I,GUCA2,STARA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATGCCTTCCTGCTCTCCGCACTGTGCCTCCTTGGGGCCTGGGCCGCCTTGGCAGGAGGGGTCACCGTGCAGGATGGAAATTTCTCCTTTTCTCTGGAGTCAGTGAAGAAGCTCAAAGACCTCCAGGAGCCCCAGGAGCCCAGGGTTGGGAAACTCAGGAACTTTGCACCCATCCCTGGTGAACCTGTGGTTCCCATCCTCTGTAGCAACCCGAACTTTCCAGAAGAACTCAAGCCTCTCTGCAAGGAGCCCAATGCCCAGGAGATACTTCAGAGGCTGGAGGAAATCGCTGAGGACCCGGGCACATGTGAAATCTGTGCCTACGCTGCCTGTACCGGATGCTAG
ORF Protein Sequence MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0249-Ab Anti-GUC2A/ GUCA2A/ GCAP-I functional antibody
    Target Antigen GM-Tg-g-SE0249-Ag GUCA2A protein
    ORF Viral Vector pGMLP003388 Human GUCA2A Lentivirus plasmid
    ORF Viral Vector vGMLP003388 Human GUCA2A Lentivirus particle


    Target information

    Target ID GM-SE0249
    Target Name GUCA2A
    Gene ID 2980, 14915, 696455, 25656, 101092627, 482446, 531794, 100053741
    Gene Symbol and Synonyms GCAP-I,GUANYL,Guanylin,GUCA2,GUCA2A,STARA
    Uniprot Accession Q02747
    Uniprot Entry Name GUC2A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197273
    Target Classification Not Available

    Predicted to enable guanylate cyclase activator activity. Predicted to be involved in positive regulation of guanylate cyclase activity and signal transduction. Predicted to be located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.