Human LUM/LDC/SLRR2D ORF/cDNA clone-Lentivirus particle (NM_002345)

Cat. No.: vGMLP003116

Pre-made Human LUM/LDC/SLRR2D Lentiviral expression plasmid for LUM lentivirus packaging, LUM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LUM/LDC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003116 Human LUM Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003116
Gene Name LUM
Accession Number NM_002345
Gene ID 4060
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1017 bp
Gene Alias LDC,SLRR2D
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTCTAAGTGCATTTACTCTCTTCCTGGCATTGATTGGTGGTACCAGTGGCCAGTACTATGATTATGATTTTCCCCTATCAATTTATGGGCAATCATCACCAAACTGTGCACCAGAATGTAACTGCCCTGAAAGCTACCCAAGTGCCATGTACTGTGATGAGCTGAAATTGAAAAGTGTACCAATGGTGCCTCCTGGAATCAAGTATCTTTACCTTAGGAATAACCAGATTGACCATATTGATGAAAAGGCCTTTGAGAATGTAACTGATCTGCAGTGGCTCATTCTAGATCACAACCTTCTAGAAAACTCCAAGATAAAAGGGAGAGTTTTCTCTAAATTGAAACAACTGAAGAAGCTGCATATAAACCACAACAACCTGACAGAGTCTGTGGGCCCACTTCCCAAATCTCTGGAGGATCTGCAGCTTACTCATAACAAGATCACAAAGCTGGGCTCTTTTGAAGGATTGGTAAACCTGACCTTCATCCATCTCCAGCACAATCGGCTGAAAGAGGATGCTGTTTCAGCTGCTTTTAAAGGTCTTAAATCACTCGAATACCTTGACTTGAGCTTCAATCAGATAGCCAGACTGCCTTCTGGTCTCCCTGTCTCTCTTCTAACTCTCTACTTAGACAACAATAAGATCAGCAACATCCCTGATGAGTATTTCAAGCGTTTTAATGCATTGCAGTATCTGCGTTTATCTCACAACGAACTGGCTGATAGTGGAATACCTGGAAATTCTTTCAATGTGTCATCCCTGGTTGAGCTGGATCTGTCCTATAACAAGCTTAAAAACATACCAACTGTCAATGAAAACCTTGAAAACTATTACCTGGAGGTCAATCAACTTGAGAAGTTTGACATAAAGAGCTTCTGCAAGATCCTGGGGCCATTATCCTACTCCAAGATCAAGCATTTGCGTTTGGATGGCAATCGCATCTCAGAAACCAGTCTTCCACCGGATATGTATGAATGTCTACGTGTTGCTAACGAAGTCACTCTTAATTAA
ORF Protein Sequence MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0329-Ab Anti-LUM/ LDC/ SLRR2D functional antibody
    Target Antigen GM-Tg-g-SE0329-Ag LUM protein
    ORF Viral Vector pGMLP003116 Human LUM Lentivirus plasmid
    ORF Viral Vector vGMLP003116 Human LUM Lentivirus particle


    Target information

    Target ID GM-SE0329
    Target Name LUM
    Gene ID 4060, 17022, 709830, 81682, 101100982, 482599, 280847, 100009681
    Gene Symbol and Synonyms LDC,LUM,SLRR2D
    Uniprot Accession P51884
    Uniprot Entry Name LUM_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000139329
    Target Classification Not Available

    This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.